BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0136 (676 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC737.08 |||midasin |Schizosaccharomyces pombe|chr 3|||Manual 28 1.4 SPBC24C6.07 |cdc14||SIN component Cdc14|Schizosaccharomyces pomb... 25 7.6 SPBC354.09c |||Tre1 family protein |Schizosaccharomyces pombe|ch... 25 10.0 SPAC922.07c |||aldehyde dehydrogenase |Schizosaccharomyces pombe... 25 10.0 >SPCC737.08 |||midasin |Schizosaccharomyces pombe|chr 3|||Manual Length = 4717 Score = 27.9 bits (59), Expect = 1.4 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 5/58 (8%) Frame = +1 Query: 190 GDSKMTCWCVPMHSVKQF-LVXSCLLYEKNVPFSLIG----GNTTSCLALINCLYSEV 348 G W PM ++ F LV CLL ++ P L+G G TT C L CL+ E+ Sbjct: 1161 GPLSKVVWTRPM--IRLFCLVWRCLLAKE--PVLLVGDTGCGKTTVCQILAECLHKEL 1214 >SPBC24C6.07 |cdc14||SIN component Cdc14|Schizosaccharomyces pombe|chr 2|||Manual Length = 240 Score = 25.4 bits (53), Expect = 7.6 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -1 Query: 112 ISRRIFLVGREDPLVESTKPC 50 I R IFL ++ PL ST PC Sbjct: 43 IPREIFLKLQDSPLYNSTTPC 63 >SPBC354.09c |||Tre1 family protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 794 Score = 25.0 bits (52), Expect = 10.0 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -3 Query: 263 NKHXXTKNCLTECIGTHQQVILESPDPASVL*SEMRLPFTFN 138 N + + LT H++ SP A+VL S + +P TFN Sbjct: 328 NHYYYVGDPLTPGWSAHEETNRISPKDANVLPSIVSIPITFN 369 >SPAC922.07c |||aldehyde dehydrogenase |Schizosaccharomyces pombe|chr 1|||Manual Length = 496 Score = 25.0 bits (52), Expect = 10.0 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = +1 Query: 274 NVPFSLIGGNTTSCLALINCLYSEVIALTQNTLYYFLTV 390 N P ++ G LA NC+ + T +L YF T+ Sbjct: 165 NYPLNMAGWKIAPALAAGNCIIIKSAETTPLSLLYFATL 203 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,464,016 Number of Sequences: 5004 Number of extensions: 44669 Number of successful extensions: 71 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 309878492 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -