BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0136 (676 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 25 2.9 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 24 5.0 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 23 6.7 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.6 bits (51), Expect = 2.9 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +1 Query: 226 HSVKQFLVXSCLLYEKNVPFSLIGGNT 306 ++ QFLV C+ Y N +++GG T Sbjct: 1190 NTTAQFLVFRCMKYFLNPNVTVLGGQT 1216 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 23.8 bits (49), Expect = 5.0 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -2 Query: 507 SAEHGNSNFFLSINKRMHFQE 445 +A NS+++ NKR+HF+E Sbjct: 176 TAFRDNSSYYTIDNKRVHFKE 196 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = -2 Query: 219 YAPTSHFGVSRSRFGALK*NAATVHVQPNP 130 Y P HF + RF N+ H+ P P Sbjct: 359 YQPLHHFSAASQRFMLRSCNSLGDHIPPLP 388 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 613,049 Number of Sequences: 2352 Number of extensions: 10689 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -