BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0136 (676 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81458-1|CAB03820.1| 274|Caenorhabditis elegans Hypothetical pr... 28 7.0 U97017-1|AAB52363.1| 2643|Caenorhabditis elegans Temporarily ass... 28 7.0 >Z81458-1|CAB03820.1| 274|Caenorhabditis elegans Hypothetical protein C03E10.1 protein. Length = 274 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +1 Query: 316 LALINCLYSEVIALTQNTLYYFL 384 L +++ + S VI LTQ+ LYYF+ Sbjct: 52 LVIVSQVISSVICLTQDDLYYFM 74 >U97017-1|AAB52363.1| 2643|Caenorhabditis elegans Temporarily assigned gene nameprotein 162 protein. Length = 2643 Score = 27.9 bits (59), Expect = 7.0 Identities = 18/61 (29%), Positives = 30/61 (49%) Frame = +1 Query: 100 SGEIFTG*IVRVRLNVNGSRISL*STEAGSGDSKMTCWCVPMHSVKQFLVXSCLLYEKNV 279 +G+I G +R+ R+ + T+A S M VP+HS +F + + + KNV Sbjct: 1887 NGDILIGEFIRIANQTTIRRLGMKGTKAIQRGSVML---VPLHSSIKFFLSTVDITAKNV 1943 Query: 280 P 282 P Sbjct: 1944 P 1944 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,464,017 Number of Sequences: 27780 Number of extensions: 246604 Number of successful extensions: 425 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 418 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 425 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1529108810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -