Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0135
         (656 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q4UH17 Cluster: Putative uncharacterized protein; n=1; ...    37   0.49 

>UniRef50_Q4UH17 Cluster: Putative uncharacterized protein; n=1;
           Theileria annulata|Rep: Putative uncharacterized protein
           - Theileria annulata
          Length = 2561

 Score = 36.7 bits (81), Expect = 0.49
 Identities = 26/71 (36%), Positives = 39/71 (54%), Gaps = 1/71 (1%)
 Frame = +3

Query: 66  FTNIDFN*EFVASNCLNLLNINMLYSS*HFATPTKNCNCKLF*KL-YLFINSLYFFPLNN 242
           F N +++  F   N LN L+ N   +  H     K+CN ++F  L + +INSL  F  NN
Sbjct: 499 FINGEYS-HFSFENDLNYLHENKEIN--HLIEVQKSCNDRIFKYLNHFYINSLTHFDNNN 555

Query: 243 NKITVSFITRL 275
           NK+T S ++ L
Sbjct: 556 NKLTSSEVSVL 566


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 491,597,746
Number of Sequences: 1657284
Number of extensions: 8356559
Number of successful extensions: 16216
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 15714
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16213
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 49586781480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)