BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0135 (656 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U64835-6|AAG24199.1| 341|Caenorhabditis elegans Serpentine rece... 29 2.2 Z79696-1|CAB01972.1| 1584|Caenorhabditis elegans Hypothetical pr... 28 6.7 >U64835-6|AAG24199.1| 341|Caenorhabditis elegans Serpentine receptor, class d (delta)protein 9 protein. Length = 341 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -2 Query: 565 VLEFLIENRVYEPRP-SNFKVSMYSIFIYVQIFSKTI 458 +L F N + P S +KV M+S+FIY+ F++ I Sbjct: 107 LLSFAYRNYILSSAPPSTWKVFMFSVFIYIPSFTQFI 143 >Z79696-1|CAB01972.1| 1584|Caenorhabditis elegans Hypothetical protein F54F3.1 protein. Length = 1584 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = -2 Query: 481 VQIFSKTIQYKVNRKCCQGHEQCNLACSFCFIVLSRYRCD 362 ++I S++ + C G QC L C +V YRC+ Sbjct: 648 IEIPSQSESISTDSVCAPGRHQCTLPNMKCRVVDPSYRCE 687 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,896,471 Number of Sequences: 27780 Number of extensions: 218864 Number of successful extensions: 465 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 465 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1465835342 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -