BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0133 (693 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g34390.1 68417.m04885 extra-large guanine nucleotide binding ... 28 6.8 At2g25660.1 68415.m03075 expressed protein 28 6.8 At3g15970.1 68416.m02019 Ran-binding protein 1 domain-containing... 27 8.9 >At4g34390.1 68417.m04885 extra-large guanine nucleotide binding protein, putative / G-protein, putative similar to extra-large G-protein (XLG) [Arabidopsis thaliana] GI:3201680; contains Pfam profile PF00503: G-protein alpha subunit Length = 861 Score = 27.9 bits (59), Expect = 6.8 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = -1 Query: 543 MKFIVYGSFFQWVLVVFESHESYSQETKGQYDSTN 439 +KFI+ + + ++ +V E+HE + +E S N Sbjct: 498 IKFIIQTNLYTYLAMVLEAHERFEKEMSNDQSSGN 532 >At2g25660.1 68415.m03075 expressed protein Length = 2146 Score = 27.9 bits (59), Expect = 6.8 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -3 Query: 349 WSHPLFWLQLKSLFHFFSSFCLVFWY 272 W LF+L+ F S CL+ WY Sbjct: 98 WEEGLFFLRCSVFFAVISGVCLLVWY 123 >At3g15970.1 68416.m02019 Ran-binding protein 1 domain-containing protein / RanBP1 domain-containing protein similar to Ran binding protein [Homo sapiens] GI:624232; contains Pfam profile PF00638: RanBP1 domain Length = 465 Score = 27.5 bits (58), Expect = 8.9 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -3 Query: 181 ACSSGFTEAGTDDADTGVASVTFSASGFTF 92 A SS + + +A TG+AS FSAS F+F Sbjct: 237 ALSSFHQHSSSKNAFTGLASTGFSASSFSF 266 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,151,291 Number of Sequences: 28952 Number of extensions: 212559 Number of successful extensions: 452 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 444 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 452 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1477286152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -