BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0131 (679 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0581 + 18986084-18986176,18986284-18986668,18986779-189868... 30 2.0 04_04_0481 - 25541355-25541849,25541933-25542535,25542730-255428... 29 2.6 02_05_1138 + 34379697-34380902 29 2.6 08_01_0432 + 3782594-3783027,3783678-3783759,3784067-3784117,378... 29 3.4 12_02_0686 - 22076741-22077085 29 4.5 03_06_0073 + 31474832-31475284 28 7.9 >08_02_0581 + 18986084-18986176,18986284-18986668,18986779-18986861, 18986966-18987110,18987823-18987951,18988047-18988171, 18988261-18988419,18988503-18988665,18988750-18988875, 18989110-18989471,18989572-18989772,18989873-18989982, 18990079-18990163,18990298-18990426,18990505-18990610, 18990688-18990776,18990885-18991184 Length = 929 Score = 29.9 bits (64), Expect = 2.0 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 44 VPSSSSYLARDRRKQFSFIGSLKGTGGMEWSH 139 +P S Y Q++F G+ GT GMEW++ Sbjct: 479 IPGFSLYRGLYELGQYAFSGNAMGTNGMEWTN 510 >04_04_0481 - 25541355-25541849,25541933-25542535,25542730-25542837, 25542925-25543260,25543391-25543461,25543692-25543824 Length = 581 Score = 29.5 bits (63), Expect = 2.6 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 245 FPPWRSWRPSVASNEEDVGSSV 180 + PW+ +RP V+S D+G SV Sbjct: 559 YKPWKRYRPDVSSKGRDIGLSV 580 >02_05_1138 + 34379697-34380902 Length = 401 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -3 Query: 287 SKIHSLVYSVTIVLFPPWRSWRPSVASNEEDVGS 186 S +HS S L PPWRS++P++ + + GS Sbjct: 356 SLVHSFDTSANPGLMPPWRSFQPTMDQDGVEDGS 389 >08_01_0432 + 3782594-3783027,3783678-3783759,3784067-3784117, 3784279-3784514,3785008-3785058,3790905-3791106, 3791695-3791977,3792617-3792687 Length = 469 Score = 29.1 bits (62), Expect = 3.4 Identities = 25/90 (27%), Positives = 36/90 (40%) Frame = +2 Query: 38 LKVPSSSSYLARDRRKQFSFIGSLKGTGGMEWSHYLIIQISPCA*IVQPMNLRLPHSMPR 217 L++ S SYL D + ++GSL GG + H + + P P LP + Sbjct: 25 LRIWKSGSYLHADEDGRSVYVGSLPRDGGGDSRHCAVWAVEPPIDAAAP----LPQYVRL 80 Query: 218 TGATNATEGTKRSLRSKQGYVSSXIAITDR 307 GA G S S ++S A DR Sbjct: 81 RGAYGRYLGAPDSYGSPLPFLSVDAAQRDR 110 >12_02_0686 - 22076741-22077085 Length = 114 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -2 Query: 123 PPVPFNDPIK-ENCFRRSRARYEDEEGTFKPNI 28 PPVP+ ++ EN RR R E EEG+ P + Sbjct: 29 PPVPYGARLRRENPIRRPRKPAEPEEGSSLPGV 61 >03_06_0073 + 31474832-31475284 Length = 150 Score = 27.9 bits (59), Expect = 7.9 Identities = 19/71 (26%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Frame = +1 Query: 94 LYRIIKRNGRDGM-VSLSHYTNIPMCVNCATDEPTSSSFDATDGRHERHGGNKTIVTE*T 270 +YR IK R+GM ++L+ N+P + C DEP + D E + Sbjct: 50 VYRCIKV--REGMFLTLATEYNMPALIGCPGDEPRMLTPYVDDDEDEDDATESPTLARGI 107 Query: 271 RLCIFEXCYYR 303 +C C +R Sbjct: 108 TVCFARTCRWR 118 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,846,980 Number of Sequences: 37544 Number of extensions: 399170 Number of successful extensions: 854 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 830 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 854 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1726796312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -