BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0131 (679 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 25 2.9 AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical prot... 24 3.8 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 24.6 bits (51), Expect = 2.9 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 205 MRKT*VHRLHNLRTWGYLYN 146 +R T HR H LRT G+ +N Sbjct: 4 LRWTSSHRAHELRTSGFAFN 23 >AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical protein protein. Length = 278 Score = 24.2 bits (50), Expect = 3.8 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +3 Query: 237 RREQNDRYGVNKAMYLRXLLLPIVRWVGVSM 329 R Q YG +K LLP+ R+VG S+ Sbjct: 29 RTHQRHVYGTSKTKNASAPLLPVDRFVGFSI 59 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 748,922 Number of Sequences: 2352 Number of extensions: 15519 Number of successful extensions: 34 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68159265 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -