BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0130 (636 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 24 0.92 DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 23 2.1 U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 21 6.5 AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain tran... 21 6.5 AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 21 6.5 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 24.2 bits (50), Expect = 0.92 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = -1 Query: 222 HGIEASLPAQWKFMDIFLEEVSTWFFF 142 H I W F+D+F+ ST F F Sbjct: 92 HAITIRSTFSWTFIDVFIMLTSTAFVF 118 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 23.0 bits (47), Expect = 2.1 Identities = 12/40 (30%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = -3 Query: 550 AIVNG*NERTLYHKIYDLLMRKYSHWRTH---WNCHILHH 440 AI N +R + IY+ +MR + ++R + W I H+ Sbjct: 95 AIRNSPEKRLTLNGIYEYIMRNFPYYRENKQGWQNSIRHN 134 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 21.4 bits (43), Expect = 6.5 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -2 Query: 170 LKKSAHGFFFLVRRKSLDFLSSLRM 96 L+K H +L RR+ ++ SLR+ Sbjct: 198 LEKEFHFNKYLTRRRRIEIAESLRL 222 >AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain transcription factor Fushitarazu protein. Length = 290 Score = 21.4 bits (43), Expect = 6.5 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -2 Query: 170 LKKSAHGFFFLVRRKSLDFLSSLRM 96 L+K H +L RR+ ++ SLR+ Sbjct: 198 LEKEFHFNKYLTRRRRIEIAESLRL 222 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 21.4 bits (43), Expect = 6.5 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -2 Query: 170 LKKSAHGFFFLVRRKSLDFLSSLRM 96 L+K H +L RR+ ++ SLR+ Sbjct: 198 LEKEFHFNKYLTRRRRIEIAESLRL 222 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,509 Number of Sequences: 336 Number of extensions: 3039 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16397237 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -