BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0126 (699 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54230| Best HMM Match : EGF (HMM E-Value=0) 37 0.014 SB_46360| Best HMM Match : EGF (HMM E-Value=0) 37 0.014 SB_6077| Best HMM Match : EGF (HMM E-Value=0) 37 0.014 SB_39378| Best HMM Match : VWA (HMM E-Value=0) 35 0.055 SB_54839| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.096 SB_50709| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_48384| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_13309| Best HMM Match : EGF (HMM E-Value=0) 33 0.17 SB_4999| Best HMM Match : EGF_CA (HMM E-Value=0) 33 0.17 SB_50111| Best HMM Match : GCC2_GCC3 (HMM E-Value=0) 33 0.22 SB_49765| Best HMM Match : EGF (HMM E-Value=0) 33 0.22 SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_31961| Best HMM Match : EGF (HMM E-Value=0) 33 0.29 SB_47132| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.29 SB_2045| Best HMM Match : EGF (HMM E-Value=0) 33 0.29 SB_16910| Best HMM Match : EGF (HMM E-Value=0) 32 0.39 SB_4760| Best HMM Match : EGF (HMM E-Value=8.29989e-42) 32 0.39 SB_18656| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_28495| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_20112| Best HMM Match : EGF (HMM E-Value=0) 32 0.51 SB_40335| Best HMM Match : EGF (HMM E-Value=2.5e-09) 32 0.51 SB_37565| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_53413| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.68 SB_34004| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.68 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 31 0.68 SB_43659| Best HMM Match : EGF_CA (HMM E-Value=2.5e-06) 31 0.68 SB_32940| Best HMM Match : EGF (HMM E-Value=0) 31 0.68 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 31 0.68 SB_3977| Best HMM Match : EGF (HMM E-Value=1.8e-09) 31 0.68 SB_25361| Best HMM Match : Cadherin (HMM E-Value=0) 31 0.90 SB_58051| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.90 SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.90 SB_15843| Best HMM Match : VWA (HMM E-Value=4.1e-35) 31 0.90 SB_40116| Best HMM Match : EGF (HMM E-Value=0) 31 1.2 SB_49700| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_58669| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_32719| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_673| Best HMM Match : VWA (HMM E-Value=8.9e-25) 30 1.6 SB_7343| Best HMM Match : EGF (HMM E-Value=0) 30 1.6 SB_6531| Best HMM Match : EGF_2 (HMM E-Value=0.0016) 30 1.6 SB_3457| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_44915| Best HMM Match : VWA (HMM E-Value=0) 30 2.1 SB_23044| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_13163| Best HMM Match : VWA (HMM E-Value=2.3e-32) 30 2.1 SB_10656| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_59261| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_26480| Best HMM Match : EGF (HMM E-Value=0) 30 2.1 SB_21404| Best HMM Match : VWA (HMM E-Value=8.1e-27) 30 2.1 SB_2152| Best HMM Match : EGF (HMM E-Value=0) 30 2.1 SB_58558| Best HMM Match : EGF (HMM E-Value=0) 29 2.7 SB_39510| Best HMM Match : VWA (HMM E-Value=0) 29 2.7 SB_33162| Best HMM Match : EGF (HMM E-Value=1.2e-06) 29 2.7 SB_27922| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_26578| Best HMM Match : EGF (HMM E-Value=2.2e-35) 29 2.7 SB_5768| Best HMM Match : EGF (HMM E-Value=3.5e-06) 29 2.7 SB_1374| Best HMM Match : PAN (HMM E-Value=0.013) 29 2.7 SB_16758| Best HMM Match : EGF_CA (HMM E-Value=5.5e-14) 29 2.7 SB_6200| Best HMM Match : Laminin_EGF (HMM E-Value=0) 29 2.7 SB_58780| Best HMM Match : VWA (HMM E-Value=1.3e-34) 29 3.6 SB_58279| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_38959| Best HMM Match : EGF (HMM E-Value=0.14) 29 3.6 SB_29518| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_21308| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_14925| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_2600| Best HMM Match : Fibrinogen_C (HMM E-Value=0.00053) 29 3.6 SB_57511| Best HMM Match : EGF_CA (HMM E-Value=0) 29 3.6 SB_55021| Best HMM Match : EGF_CA (HMM E-Value=1.4013e-45) 29 3.6 SB_45836| Best HMM Match : EGF (HMM E-Value=6.7e-21) 29 3.6 SB_42216| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_35194| Best HMM Match : EGF_2 (HMM E-Value=0) 29 3.6 SB_32355| Best HMM Match : Laminin_EGF (HMM E-Value=0) 29 3.6 SB_24499| Best HMM Match : Fibrinogen_C (HMM E-Value=0.00053) 29 3.6 SB_24275| Best HMM Match : OGFr_III (HMM E-Value=8e-05) 29 3.6 SB_23589| Best HMM Match : OGFr_III (HMM E-Value=8e-05) 29 3.6 SB_15637| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_10956| Best HMM Match : EGF (HMM E-Value=5.3e-05) 29 3.6 SB_7993| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_3578| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_3456| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_57139| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_18560| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_4940| Best HMM Match : DUF755 (HMM E-Value=2.3) 29 4.8 SB_45116| Best HMM Match : EGF (HMM E-Value=0) 29 4.8 SB_16746| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_8425| Best HMM Match : EGF (HMM E-Value=0) 29 4.8 SB_56964| Best HMM Match : Zona_pellucida (HMM E-Value=0) 28 6.3 SB_44403| Best HMM Match : EGF (HMM E-Value=0.053) 28 6.3 SB_42051| Best HMM Match : EGF_CA (HMM E-Value=6.9e-35) 28 6.3 SB_22511| Best HMM Match : EGF (HMM E-Value=0.053) 28 6.3 SB_20919| Best HMM Match : WSC (HMM E-Value=1.1e-12) 28 6.3 SB_8544| Best HMM Match : EGF (HMM E-Value=0.053) 28 6.3 SB_6365| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_57080| Best HMM Match : EGF_CA (HMM E-Value=1.4013e-43) 28 6.3 SB_56451| Best HMM Match : EGF (HMM E-Value=0.053) 28 6.3 SB_55780| Best HMM Match : EGF (HMM E-Value=0.053) 28 6.3 SB_53139| Best HMM Match : EGF (HMM E-Value=3.2e-08) 28 6.3 SB_49785| Best HMM Match : EGF (HMM E-Value=0.00078) 28 6.3 SB_44311| Best HMM Match : EGF (HMM E-Value=0.048) 28 6.3 SB_41738| Best HMM Match : EGF (HMM E-Value=0.053) 28 6.3 SB_24013| Best HMM Match : EGF (HMM E-Value=0.053) 28 6.3 SB_24004| Best HMM Match : EGF (HMM E-Value=5.7e-14) 28 6.3 SB_1588| Best HMM Match : EGF (HMM E-Value=0.053) 28 6.3 SB_49120| Best HMM Match : F5_F8_type_C (HMM E-Value=1.1e-08) 28 8.4 SB_42355| Best HMM Match : EGF (HMM E-Value=2.9e-05) 28 8.4 SB_28657| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_24529| Best HMM Match : Lectin_C (HMM E-Value=3.4e-27) 28 8.4 SB_22536| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) 28 8.4 SB_786| Best HMM Match : EGF (HMM E-Value=0) 28 8.4 SB_54456| Best HMM Match : EGF (HMM E-Value=2.3e-31) 28 8.4 SB_39527| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_18365| Best HMM Match : EGF (HMM E-Value=0.00021) 28 8.4 SB_16968| Best HMM Match : Laminin_EGF (HMM E-Value=0) 28 8.4 SB_4118| Best HMM Match : EGF (HMM E-Value=1.8e-20) 28 8.4 SB_3431| Best HMM Match : EGF (HMM E-Value=1.8e-08) 28 8.4 >SB_54230| Best HMM Match : EGF (HMM E-Value=0) Length = 1359 Score = 37.1 bits (82), Expect = 0.014 Identities = 24/74 (32%), Positives = 34/74 (45%), Gaps = 9/74 (12%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD-----VIPANMTTTE----ASTVQEFTVEVITDDGSAENTSDK 101 G YRC CP G TG+HC+ VI T STV T+ V+ D A+ + Sbjct: 1078 GDYRCSCPPGFTGQHCEKAWTSVISRQTTLVRMERPVSTVTVATLAVVLADSPAKTMTKA 1137 Query: 100 TTTVAEPNIDENET 59 + + ++NET Sbjct: 1138 WSPCSVTCGNDNET 1151 Score = 36.7 bits (81), Expect = 0.018 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G YRC CP G+TG+HC+ Sbjct: 741 GKYRCSCPDGLTGRHCE 757 Score = 33.9 bits (74), Expect = 0.13 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = -3 Query: 262 STGGHYRCQCPSGVTGKHCD 203 +T G Y C CP+G+TGK+C+ Sbjct: 777 NTYGSYSCACPTGLTGKNCE 796 Score = 32.3 bits (70), Expect = 0.39 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C C SG TGKHC+ Sbjct: 858 GAYTCTCASGFTGKHCE 874 Score = 31.1 bits (67), Expect = 0.90 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C C +G TGKHC+ Sbjct: 1039 GTYTCTCATGYTGKHCE 1055 >SB_46360| Best HMM Match : EGF (HMM E-Value=0) Length = 352 Score = 37.1 bits (82), Expect = 0.014 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDV 200 Y C CP+GVTG+HCDV Sbjct: 185 YSCSCPTGVTGRHCDV 200 Score = 29.1 bits (62), Expect = 3.6 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDVI 197 Y+C C G GKHC++I Sbjct: 259 YKCSCLEGYYGKHCELI 275 >SB_6077| Best HMM Match : EGF (HMM E-Value=0) Length = 1165 Score = 37.1 bits (82), Expect = 0.014 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDV 200 Y C CP+GVTG+HCDV Sbjct: 998 YSCSCPTGVTGRHCDV 1013 Score = 31.5 bits (68), Expect = 0.68 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCDV 200 G Y+C CPSG +G++C V Sbjct: 235 GEYKCICPSGFSGENCQV 252 Score = 30.7 bits (66), Expect = 1.2 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDV 200 Y+C C G TG+HCDV Sbjct: 313 YQCTCLPGFTGRHCDV 328 Score = 29.1 bits (62), Expect = 3.6 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDVI 197 Y+C C G GKHC++I Sbjct: 1072 YKCSCLEGYYGKHCELI 1088 Score = 28.7 bits (61), Expect = 4.8 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 Query: 247 YRCQCPSGVTGKHCD 203 + CQCP G+TG+ C+ Sbjct: 161 FSCQCPQGITGQTCN 175 Score = 28.7 bits (61), Expect = 4.8 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -3 Query: 274 SIVGSTGGHYRCQCPSGVTGKHCD 203 S + +Y C+CP G TG C+ Sbjct: 532 SCFSNNSTYYTCECPKGYTGHDCE 555 Score = 27.9 bits (59), Expect = 8.4 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -3 Query: 250 HYRCQCPSGVTGKHCDV 200 +Y C CP G TG CDV Sbjct: 578 NYTCICPRGFTGTLCDV 594 >SB_39378| Best HMM Match : VWA (HMM E-Value=0) Length = 2865 Score = 35.1 bits (77), Expect = 0.055 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCDV 200 G Y CQC G TGKHCD+ Sbjct: 1465 GAYSCQCSDGFTGKHCDL 1482 Score = 32.3 bits (70), Expect = 0.39 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDVIP 194 Y C C G GKHC+++P Sbjct: 2142 YTCSCREGFAGKHCEIVP 2159 Score = 29.9 bits (64), Expect = 2.1 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 262 STGGHYRCQCPSGVTGKHC 206 S+G Y C C +G TGK+C Sbjct: 431 SSGSDYTCACAAGYTGKNC 449 >SB_54839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1409 Score = 34.3 bits (75), Expect = 0.096 Identities = 17/65 (26%), Positives = 28/65 (43%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCDVIPANMTTTEASTVQEFTVEVITDDGSAENTSDKTTTVAEPNI 74 G Y C C +G TGK+C+ E + V+ S T +KT + + Sbjct: 59 GGYSCACKAGFTGKNCEQAYTRAKMAEYAKTNMVDTLVLAKQDSRAKTVNKTAFLLLNPL 118 Query: 73 DENET 59 D++E+ Sbjct: 119 DQSES 123 Score = 31.1 bits (67), Expect = 0.90 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -3 Query: 271 IVGSTGGHYRCQCPSGVTGKHCD 203 + ++ G Y C+C SG TGK+C+ Sbjct: 1245 VCSNSHGGYSCKCASGYTGKNCE 1267 Score = 30.3 bits (65), Expect = 1.6 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCDVIPA 191 G Y C C +G TGK+C+ P+ Sbjct: 336 GGYSCACKAGFTGKNCEQAPS 356 Score = 30.3 bits (65), Expect = 1.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 262 STGGHYRCQCPSGVTGKHCD 203 +T G Y+C C TGKHC+ Sbjct: 1286 NTPGSYKCNCIDEYTGKHCE 1305 Score = 29.5 bits (63), Expect = 2.7 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C C SG TGK+C+ Sbjct: 679 GAYSCTCKSGFTGKNCE 695 Score = 28.3 bits (60), Expect = 6.3 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C C +G TGK+C+ Sbjct: 298 GGYSCACKAGFTGKNCE 314 Score = 28.3 bits (60), Expect = 6.3 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C C +G TGK+C+ Sbjct: 481 GGYSCACKAGFTGKNCE 497 Score = 28.3 bits (60), Expect = 6.3 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C C +G TGK+C+ Sbjct: 519 GGYSCACKAGFTGKNCE 535 Score = 28.3 bits (60), Expect = 6.3 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C C +G TGK+C+ Sbjct: 717 GGYSCACKAGFTGKNCE 733 Score = 28.3 bits (60), Expect = 6.3 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C C +G TGK+C+ Sbjct: 755 GGYSCACKAGFTGKNCE 771 Score = 28.3 bits (60), Expect = 6.3 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C C +G TGK+C+ Sbjct: 832 GGYSCTCKAGFTGKNCE 848 Score = 28.3 bits (60), Expect = 6.3 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C C +G TGK+C+ Sbjct: 908 GGYSCACKAGFTGKNCE 924 Score = 28.3 bits (60), Expect = 6.3 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C C +G TGK+C+ Sbjct: 946 GGYSCACKAGFTGKNCE 962 Score = 28.3 bits (60), Expect = 6.3 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C C +G TGK+C+ Sbjct: 984 GGYSCACKAGFTGKNCE 1000 Score = 28.3 bits (60), Expect = 6.3 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C C +G TGK+C+ Sbjct: 1174 GGYSCTCKAGFTGKNCE 1190 Score = 27.9 bits (59), Expect = 8.4 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C C +G TGK+C+ Sbjct: 1212 GGYSCVCKAGFTGKNCE 1228 >SB_50709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 953 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDVIPANMTT 179 YRC C SG TGK+C+V TT Sbjct: 599 YRCMCKSGFTGKNCEVEEDECTT 621 >SB_48384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1678 Score = 33.5 bits (73), Expect = 0.17 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 3/40 (7%) Frame = -3 Query: 274 SIVGSTGGHYRCQCPSGVTGKHCDVI---PANMTTTEAST 164 SI +T G ++C C SG T K + + PAN+T+ + T Sbjct: 989 SICENTDGSFKCSCKSGYTPKFSEAVGDAPANLTSCDGKT 1028 Score = 32.7 bits (71), Expect = 0.29 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 3/56 (5%) Frame = -3 Query: 274 SIVGSTGGHYRCQCPSGVTGKHCDVI---PANMTTTEASTVQEFTVEVITDDGSAE 116 SI +T G ++C C SG T K + + PAN+T+ + + E + V T SA+ Sbjct: 895 SICENTDGSFKCSCKSGYTPKFSEAVGDAPANLTSCD--DIDECGLGVATCPASAD 948 >SB_13309| Best HMM Match : EGF (HMM E-Value=0) Length = 718 Score = 33.5 bits (73), Expect = 0.17 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = -3 Query: 271 IVGSTGGHYRCQCPSGVTGKHCDV 200 + ++ G Y C+C SG TGK+C++ Sbjct: 514 VCANSPGRYSCECASGYTGKNCEI 537 Score = 31.5 bits (68), Expect = 0.68 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 268 VGSTGGHYRCQCPSGVTGKHCD 203 + S GG Y C+C G +GKHC+ Sbjct: 593 INSDGG-YSCECKGGYSGKHCE 613 Score = 30.3 bits (65), Expect = 1.6 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C+C SG TGK+C+ Sbjct: 403 GGYSCKCASGYTGKNCE 419 Score = 30.3 bits (65), Expect = 1.6 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C+C SG TGK+C+ Sbjct: 442 GGYSCKCASGYTGKNCE 458 Score = 30.3 bits (65), Expect = 1.6 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C+C SG TGK+C+ Sbjct: 481 GGYSCKCASGYTGKNCE 497 Score = 30.3 bits (65), Expect = 1.6 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C+C SG TGK+C+ Sbjct: 559 GGYSCKCASGYTGKNCE 575 >SB_4999| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 1054 Score = 33.5 bits (73), Expect = 0.17 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 3/40 (7%) Frame = -3 Query: 274 SIVGSTGGHYRCQCPSGVTGKHCDVI---PANMTTTEAST 164 SI +T G ++C C SG T K + + PAN+T+ + T Sbjct: 158 SICENTDGSFKCSCKSGYTPKFSEAVGDAPANLTSCDGKT 197 Score = 32.7 bits (71), Expect = 0.29 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = -3 Query: 274 SIVGSTGGHYRCQCPSGVTGKHCDVI---PANMTTTEASTVQEFTVEVITDDGSAE 116 SI +T G + C C SG T K + + PAN+T+ + + E + V T SA+ Sbjct: 64 SICENTDGSFNCSCKSGYTPKFSEAVGDAPANLTSCD--DIDECALGVATCPASAD 117 >SB_50111| Best HMM Match : GCC2_GCC3 (HMM E-Value=0) Length = 1115 Score = 33.1 bits (72), Expect = 0.22 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 Query: 256 GGHYRCQCPSGVTGKHCDVI 197 G + C CPSG+TGK C+ + Sbjct: 768 GNRFVCMCPSGLTGKRCETV 787 >SB_49765| Best HMM Match : EGF (HMM E-Value=0) Length = 508 Score = 33.1 bits (72), Expect = 0.22 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -3 Query: 256 GGHYRCQCPSGVTGKHCD-VIPANMTTTEAS 167 G +Y C C G TG+HCD VIP ++ S Sbjct: 220 GKNYTCTCSPGYTGRHCDTVIPKACVSSPCS 250 Score = 32.7 bits (71), Expect = 0.29 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -3 Query: 256 GGHYRCQCPSGVTGKHCD-VIP 194 G +Y C C G TG+HCD VIP Sbjct: 137 GKNYTCTCSPGYTGRHCDTVIP 158 Score = 32.7 bits (71), Expect = 0.29 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -3 Query: 256 GGHYRCQCPSGVTGKHCD-VIP 194 G +Y C C G TG+HCD VIP Sbjct: 179 GKNYTCTCSPGYTGRHCDTVIP 200 Score = 31.1 bits (67), Expect = 0.90 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 256 GGHYRCQCPSGVTGKHCD 203 G +Y C C G TG+HCD Sbjct: 261 GKNYTCTCSPGYTGRHCD 278 Score = 29.9 bits (64), Expect = 2.1 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 256 GGHYRCQCPSGVTGKHCDVI 197 G +Y C C G TG+HC+ + Sbjct: 327 GKNYTCSCSYGYTGRHCNTL 346 >SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5659 Score = 33.1 bits (72), Expect = 0.22 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 3/59 (5%) Frame = -3 Query: 253 GHYRCQCPSGVT--GKHCD-VIPANMTTTEASTVQEFTVEVITDDGSAENTSDKTTTVA 86 G Y CQC G T GK+C +I + TT + +TV + + + T TTVA Sbjct: 726 GSYNCQCMEGYTGDGKNCQAIITKSPTTLQQTTVAPESTAAPETSVAPDTTMGPKTTVA 784 >SB_31961| Best HMM Match : EGF (HMM E-Value=0) Length = 2813 Score = 32.7 bits (71), Expect = 0.29 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDVIP 194 Y C CPSG TG C+++P Sbjct: 902 YLCTCPSGYTGTKCEIVP 919 Score = 32.3 bits (70), Expect = 0.39 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCDVIPANMTTTE 173 G+Y C CP G GKHC+ + + +T + Sbjct: 1840 GYYLCICPPGFYGKHCENLASTGSTAK 1866 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/64 (28%), Positives = 29/64 (45%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDVIPANMTTTEASTVQEFTVEVITDDGSAENTSDKTTTVAEPNIDE 68 YRC C +G TG+HC+ ++ + T + D + ++ T E NIDE Sbjct: 1500 YRCFCKAGYTGRHCETDIDECASSPCA--NGGTCTDLVDAHKCQCSTGYTGKNCEVNIDE 1557 Query: 67 NETE 56 T+ Sbjct: 1558 CATK 1561 Score = 27.9 bits (59), Expect = 8.4 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -3 Query: 241 CQCPSGVTGKHCD 203 C CP+G TGK+C+ Sbjct: 1909 CTCPTGFTGKYCE 1921 >SB_47132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 32.7 bits (71), Expect = 0.29 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 Query: 271 IVGSTGGHYRCQCPSGVTGKHCD 203 I S GG RC CP G TG+ C+ Sbjct: 75 ICKSVGGEIRCTCPGGWTGQRCE 97 >SB_2045| Best HMM Match : EGF (HMM E-Value=0) Length = 1101 Score = 32.7 bits (71), Expect = 0.29 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDV 200 Y C+CP G TG+HC++ Sbjct: 689 YTCECPLGFTGRHCEI 704 Score = 30.3 bits (65), Expect = 1.6 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = -3 Query: 292 QKRWTMSIVGSTGGHYRCQCPSGVTGKHCDV 200 Q+ T ++V +T YRC+C G +G++C++ Sbjct: 789 QRNGTCAVVPNT--LYRCECKEGYSGRNCEI 817 Score = 29.9 bits (64), Expect = 2.1 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDV 200 Y C CP G TGK C++ Sbjct: 611 YNCSCPVGFTGKDCEI 626 Score = 29.9 bits (64), Expect = 2.1 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCDVIP 194 G+YRC C G G +C++ P Sbjct: 763 GYYRCLCKEGYNGTNCEIDP 782 Score = 27.9 bits (59), Expect = 8.4 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = -3 Query: 259 TGGHYRCQCPSGVTGKHCDV 200 TG ++ C C G TG++C++ Sbjct: 968 TGTNFTCLCNPGFTGRYCEI 987 >SB_16910| Best HMM Match : EGF (HMM E-Value=0) Length = 1552 Score = 32.3 bits (70), Expect = 0.39 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 Query: 256 GGHYRCQCPSGVTGKHCDV 200 GG +RC C G TG HC + Sbjct: 968 GGDFRCACDEGYTGNHCHI 986 Score = 31.5 bits (68), Expect = 0.68 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCDVIPANMTTTEASTVQEFTVEVITD 131 G Y C CP G GK+C+V N+ + +Q V D Sbjct: 1160 GDYTCVCPPGKIGKNCEVNDPNLCRYGDNQLQSHNTTVKED 1200 Score = 29.1 bits (62), Expect = 3.6 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDVI 197 Y C CP G TGK+C ++ Sbjct: 532 YTCHCPLGYTGKNCGLL 548 Score = 28.3 bits (60), Expect = 6.3 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 Query: 247 YRCQCPSGVTGKHCD 203 ++C+CP G TGK C+ Sbjct: 841 FQCKCPVGFTGKRCE 855 Score = 27.9 bits (59), Expect = 8.4 Identities = 17/65 (26%), Positives = 27/65 (41%), Gaps = 3/65 (4%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCDV--IPANMTTTEASTVQEFTVEVITDDGS-AENTSDKTTTVAE 83 G Y+C C G +G++C V + N + ++D GS + T E Sbjct: 605 GDYKCVCSDGYSGRNCSVPSVDGNNACNPDPCLHGAACIFLSDGGSQCQCLPGYTGAFCE 664 Query: 82 PNIDE 68 NI+E Sbjct: 665 TNINE 669 >SB_4760| Best HMM Match : EGF (HMM E-Value=8.29989e-42) Length = 240 Score = 32.3 bits (70), Expect = 0.39 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -3 Query: 259 TGGHYRCQCPSGVTGKHCDVI 197 +G Y C CPSG G+ CDVI Sbjct: 95 SGTGYECSCPSGYRGEVCDVI 115 >SB_18656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3292 Score = 32.3 bits (70), Expect = 0.39 Identities = 16/69 (23%), Positives = 28/69 (40%) Frame = -3 Query: 262 STGGHYRCQCPSGVTGKHCDVIPANMTTTEASTVQEFTVEVITDDGSAENTSDKTTTVAE 83 +T G Y C+CP GK CD + A T I ++ + N ++ Sbjct: 1642 NTWGTYLCRCPENYGGKQCDKGKSMFGNNNAIATSTTTSTSIGNNNNNNNNNNNDNDNDN 1701 Query: 82 PNIDENETE 56 N ++N+ + Sbjct: 1702 DNDNDNDND 1710 >SB_28495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6753 Score = 31.9 bits (69), Expect = 0.51 Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 2/66 (3%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCDVIPANMTTTEASTVQEFTVEVITDD-GSAENTSDKTTTVAEP- 80 G Y C C S +GKHC+ N+ + V + + V DD G+ + + V Sbjct: 3936 GSYSCNCSSAYSGKHCE-FGCNIKKVNLAFVVDASTSVNQDDPGNYQRMKNLVNNVISTY 3994 Query: 79 NIDENE 62 I EN+ Sbjct: 3995 KISEND 4000 Score = 30.7 bits (66), Expect = 1.2 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y CQC +G TG+HC+ Sbjct: 619 GLYSCQCLAGYTGQHCE 635 Score = 29.5 bits (63), Expect = 2.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHC 206 G YRC C SG GK+C Sbjct: 394 GDYRCSCVSGYCGKYC 409 Score = 29.5 bits (63), Expect = 2.7 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C CP+ TGK+C+ Sbjct: 2594 GDYECDCPNKYTGKNCE 2610 Score = 29.1 bits (62), Expect = 3.6 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G YRC+C G GK+C+ Sbjct: 1887 GEYRCKCAKGFCGKNCN 1903 Score = 29.1 bits (62), Expect = 3.6 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -3 Query: 262 STGGHYRCQCPSGVTGKHCDVI 197 ++G Y C C S TGK+C+++ Sbjct: 3072 NSGSSYICTCTSEFTGKNCEIV 3093 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -1 Query: 324 LNYCEDHPDTCKNGGQCQ 271 +N C D PD CKNGG C+ Sbjct: 3916 VNECND-PDLCKNGGVCK 3932 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -1 Query: 324 LNYCEDHPDTCKNGGQCQSL 265 +N C+D P C+NGG CQ L Sbjct: 3133 VNECDD-PARCQNGGTCQDL 3151 Score = 27.9 bits (59), Expect = 8.4 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -3 Query: 262 STGGHYRCQCPSGVTGKHCD 203 + G Y C CP +G+HC+ Sbjct: 1322 AAAGRYSCACPVRFSGEHCE 1341 >SB_20112| Best HMM Match : EGF (HMM E-Value=0) Length = 2112 Score = 31.9 bits (69), Expect = 0.51 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCDV 200 G Y CQC G G+HCD+ Sbjct: 933 GAYHCQCKQGFLGRHCDL 950 Score = 31.5 bits (68), Expect = 0.68 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDV 200 Y C CP G GKHC+V Sbjct: 857 YLCSCPKGYIGKHCEV 872 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -3 Query: 274 SIVGSTGGHYRCQCPSGVTGKHCD 203 S V ST Y CQC G TG++C+ Sbjct: 579 SCVSSTPYAYSCQCKPGYTGQYCE 602 Score = 30.3 bits (65), Expect = 1.6 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDV 200 Y CQCP G TG C++ Sbjct: 663 YTCQCPKGFTGPRCEI 678 Score = 29.9 bits (64), Expect = 2.1 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -3 Query: 250 HYRCQCPSGVTGKHCDV 200 +Y C C +G TGK+CD+ Sbjct: 819 NYTCTCTAGFTGKNCDI 835 Score = 29.5 bits (63), Expect = 2.7 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 247 YRCQCPSGVTGKHCD 203 +RCQCP G TG C+ Sbjct: 435 FRCQCPLGFTGNRCE 449 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -3 Query: 268 VGSTGGHYRCQCPSGVTGKHCDV 200 V S G C C SG TGK+CDV Sbjct: 237 VTSFSGKASCICNSGWTGKNCDV 259 Score = 29.1 bits (62), Expect = 3.6 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDVI 197 Y+C CPS + GK+C+ + Sbjct: 1087 YKCDCPSKMIGKNCETV 1103 Score = 27.9 bits (59), Expect = 8.4 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDV 200 Y C+C G TGK+C+V Sbjct: 549 YYCRCRDGYTGKNCEV 564 >SB_40335| Best HMM Match : EGF (HMM E-Value=2.5e-09) Length = 309 Score = 31.9 bits (69), Expect = 0.51 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -3 Query: 247 YRCQCPSGVTGKHCD 203 Y+C C SG TGKHC+ Sbjct: 172 YKCACASGFTGKHCE 186 >SB_37565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 286 Score = 31.9 bits (69), Expect = 0.51 Identities = 9/27 (33%), Positives = 19/27 (70%) Frame = -3 Query: 250 HYRCQCPSGVTGKHCDVIPANMTTTEA 170 +Y C+C +GV+G++C+ +P + + A Sbjct: 151 NYTCRCQAGVSGRNCEKVPTSCASIRA 177 Score = 27.9 bits (59), Expect = 8.4 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDV 200 Y C+C G TGK+C++ Sbjct: 114 YTCKCQPGYTGKNCEI 129 >SB_53413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 31.5 bits (68), Expect = 0.68 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 3/37 (8%) Frame = -3 Query: 274 SIVGSTGGHYRCQCPSGVTGKHCDVI---PANMTTTE 173 SI +T G ++C C SG T K + + PAN+T+ + Sbjct: 17 SICENTDGSFKCSCKSGYTPKFSEAVGDAPANLTSCD 53 >SB_34004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 31.5 bits (68), Expect = 0.68 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = -3 Query: 274 SIVGSTGGHYRCQCPSGVTGKHCD 203 S + + GG Y C+C SG TGK+C+ Sbjct: 141 SCINNEGG-YTCKCTSGFTGKNCE 163 Score = 31.5 bits (68), Expect = 0.68 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = -3 Query: 274 SIVGSTGGHYRCQCPSGVTGKHCD 203 S + + GG Y C+C SG TGK+C+ Sbjct: 180 SCINNKGG-YTCKCTSGFTGKNCE 202 >SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) Length = 184 Score = 31.5 bits (68), Expect = 0.68 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -3 Query: 277 MSIVGSTGG-HYRCQCPSGVTGKHCD 203 M+ VG G YRC+CP G TG C+ Sbjct: 115 MTCVGLKGAPRYRCECPQGYTGIACE 140 >SB_43659| Best HMM Match : EGF_CA (HMM E-Value=2.5e-06) Length = 54 Score = 31.5 bits (68), Expect = 0.68 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 3/37 (8%) Frame = -3 Query: 274 SIVGSTGGHYRCQCPSGVTGKHCDVI---PANMTTTE 173 SI +T G ++C C SG T K + + PAN+T+ + Sbjct: 17 SICENTDGSFKCSCKSGYTPKFSEAVGDAPANLTSCD 53 >SB_32940| Best HMM Match : EGF (HMM E-Value=0) Length = 1025 Score = 31.5 bits (68), Expect = 0.68 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDVIPANMTTTEASTVQEFTVEVITDD 128 + C C G TGK C+++ + TT+ S Q ++++T+D Sbjct: 611 FECFCKPGFTGKTCELLDGSRTTSIPS--QALRLQLLTED 648 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -3 Query: 256 GGHYRCQCPSGVTGKHCDVIPANMTT 179 G ++ C CP G G C+V P T Sbjct: 68 GTNFLCDCPQGYRGDRCEVRPGQCIT 93 Score = 28.7 bits (61), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 247 YRCQCPSGVTGKHCD 203 + C CP G TGK CD Sbjct: 421 FHCSCPRGYTGKTCD 435 Score = 27.9 bits (59), Expect = 8.4 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -3 Query: 250 HYRCQCPSGVTGKHCD 203 +YRC C G G+HC+ Sbjct: 533 NYRCDCGHGYRGRHCE 548 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 31.5 bits (68), Expect = 0.68 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -3 Query: 256 GGHYRCQCPSGVTGKHCDVIP 194 G +RC C G+TGK C+ +P Sbjct: 931 GNDFRCTCSLGLTGKRCESLP 951 >SB_3977| Best HMM Match : EGF (HMM E-Value=1.8e-09) Length = 108 Score = 31.5 bits (68), Expect = 0.68 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 262 STGGHYRCQCPSGVTGKHCDVI 197 +T +YRCQCP G G +C+ I Sbjct: 35 ATLNNYRCQCPEGYRGSNCEGI 56 >SB_25361| Best HMM Match : Cadherin (HMM E-Value=0) Length = 4833 Score = 31.1 bits (67), Expect = 0.90 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -3 Query: 274 SIVGSTGGHYRCQCPSGVTGKHCDV 200 S +T G Y C C G TG++CDV Sbjct: 3749 SACDNTPGGYTCTCKPGYTGQNCDV 3773 >SB_58051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 31.1 bits (67), Expect = 0.90 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 256 GGHYRCQCPSGVTGKHCD 203 G +Y C C G TG+HCD Sbjct: 23 GKNYTCTCSPGYTGRHCD 40 >SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3287 Score = 31.1 bits (67), Expect = 0.90 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -3 Query: 262 STGGHYRCQCPSGVTGKHCDV 200 + GG Y C C SG TG CDV Sbjct: 1706 NAGGAYNCTCLSGWTGDKCDV 1726 Score = 29.9 bits (64), Expect = 2.1 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCDV 200 G+Y C+CP G G++C++ Sbjct: 2072 GNYSCRCPYGYEGRNCEI 2089 Score = 29.5 bits (63), Expect = 2.7 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 247 YRCQCPSGVTGKHCD 203 YRCQCP+G G C+ Sbjct: 1228 YRCQCPTGFAGTFCE 1242 Score = 29.5 bits (63), Expect = 2.7 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDVI 197 +RCQC G TGK C+ I Sbjct: 1749 FRCQCAVGFTGKFCEAI 1765 Score = 29.5 bits (63), Expect = 2.7 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 GH +C CP+G TG C+ Sbjct: 1997 GHVKCTCPTGFTGALCE 2013 Score = 28.7 bits (61), Expect = 4.8 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDV 200 Y C CP G TG CDV Sbjct: 763 YTCACPLGYTGNACDV 778 Score = 28.7 bits (61), Expect = 4.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCDV 200 G + C CP G TGK C++ Sbjct: 889 GDFSCACPVGYTGKLCEI 906 Score = 28.3 bits (60), Expect = 6.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G YRC C G G+HC+ Sbjct: 2927 GGYRCTCVEGYFGEHCE 2943 Score = 27.9 bits (59), Expect = 8.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCDVIPANMTTT 176 G YRCQC TG +C++ N +++ Sbjct: 1786 GKYRCQCALDFTGFNCEIRVNNCSSS 1811 Score = 27.9 bits (59), Expect = 8.4 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDVI 197 Y C CP G GK C+ + Sbjct: 1826 YNCTCPGGYYGKQCETV 1842 Score = 27.9 bits (59), Expect = 8.4 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCDV 200 G Y C+CP G G+ C++ Sbjct: 2848 GSYSCECPRGFAGRLCEL 2865 >SB_15843| Best HMM Match : VWA (HMM E-Value=4.1e-35) Length = 1686 Score = 31.1 bits (67), Expect = 0.90 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -3 Query: 262 STGGHYRCQCPSGVTGKHCDV 200 S G ++ C CP G TGK+C V Sbjct: 1466 SFGSNFTCTCPYGYTGKNCTV 1486 >SB_40116| Best HMM Match : EGF (HMM E-Value=0) Length = 340 Score = 30.7 bits (66), Expect = 1.2 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 268 VGSTGGHYRCQCPSGVTGKHCDV 200 V S GH+ C CP G G+ C++ Sbjct: 227 VSSVYGHWFCVCPKGFKGERCEI 249 Score = 27.9 bits (59), Expect = 8.4 Identities = 11/20 (55%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDV-IPA 191 Y C C G TGK+C++ IPA Sbjct: 273 YSCICREGFTGKNCEIGIPA 292 >SB_49700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 7645 Score = 30.7 bits (66), Expect = 1.2 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 268 VGSTGGHYRCQCPSGVTGKHCDV 200 V S GH+ C CP G G+ C++ Sbjct: 7271 VSSVYGHWFCVCPKGFKGERCEI 7293 >SB_58669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3038 Score = 30.3 bits (65), Expect = 1.6 Identities = 22/67 (32%), Positives = 30/67 (44%) Frame = -3 Query: 259 TGGHYRCQCPSGVTGKHCDVIPANMTTTEASTVQEFTVEVITDDGSAENTSDKTTTVAEP 80 +GGH+R CP T C V E T+ F+V+ D + +N DK+ A P Sbjct: 507 SGGHFRDTCPK--TTFKCQVKGCGK---EHHTLLHFSVQE-RKDNTVDNKIDKSPGQARP 560 Query: 79 NIDENET 59 N ET Sbjct: 561 NASAPET 567 >SB_32719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 604 Score = 30.3 bits (65), Expect = 1.6 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -3 Query: 256 GGHYRCQCPSGVTGKHCDVI 197 G Y+C CP GKHC+ + Sbjct: 211 GASYKCNCPPEFYGKHCEAL 230 Score = 29.1 bits (62), Expect = 3.6 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 247 YRCQCPSGVTGKHCD 203 Y C CP G GK+CD Sbjct: 328 YECDCPEGFYGKNCD 342 >SB_673| Best HMM Match : VWA (HMM E-Value=8.9e-25) Length = 257 Score = 30.3 bits (65), Expect = 1.6 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -3 Query: 274 SIVGSTGGHYRCQCPSGVTGKHCDV 200 ++ +T G Y C CP GV G +C++ Sbjct: 232 AVCKNTEGSYLCACPIGVKGVNCEI 256 >SB_7343| Best HMM Match : EGF (HMM E-Value=0) Length = 1233 Score = 30.3 bits (65), Expect = 1.6 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDVIPA 191 Y C+CPSG GK C +I A Sbjct: 709 YDCKCPSGYQGKSCTLISA 727 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = -3 Query: 268 VGSTGGH-YRCQCPSGVTGKHC-DVIPANM---TTTEASTVQEFTV 146 VGS G Y C C G TG++C ++ P++ T + +S +Q+ + Sbjct: 398 VGSDGSAGYNCTCIEGFTGENCSEITPSSSSVPTPSSSSDIQKTAI 443 >SB_6531| Best HMM Match : EGF_2 (HMM E-Value=0.0016) Length = 407 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -3 Query: 244 RCQCPSGVTGKHCDVIPANMTTTEASTVQEFTVEVITDDG 125 +C CP G GK C+ P + T A+ V V I +G Sbjct: 120 KCICPKGYNGKECENGPPDCETLRAAGVTASGVHKIYPEG 159 >SB_3457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 848 Score = 30.3 bits (65), Expect = 1.6 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDVIPANMTTTEASTVQE 155 Y C CP+G G+HC+ +N +T Q+ Sbjct: 315 YECACPAGFMGRHCEGKVSNPHLPNHTTSQQ 345 >SB_44915| Best HMM Match : VWA (HMM E-Value=0) Length = 541 Score = 29.9 bits (64), Expect = 2.1 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 262 STGGHYRCQCPSGVTGKHC 206 S+G Y C C +G TGK+C Sbjct: 280 SSGSDYTCACAAGYTGKNC 298 >SB_23044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2162 Score = 29.9 bits (64), Expect = 2.1 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDV 200 + C CP+G TGK CD+ Sbjct: 601 FTCACPTGYTGKTCDI 616 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDVIPANMTTTEASTVQEFTVE 143 ++C CP G G C+ + ANMT A T E Sbjct: 1669 FKCACPEGYAGMVCN-LTANMTCAHAPCFNGSTCE 1702 Score = 27.9 bits (59), Expect = 8.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 250 HYRCQCPSGVTGKHCDV 200 +Y C C SG TG++C++ Sbjct: 1757 NYSCACVSGFTGRNCEI 1773 >SB_13163| Best HMM Match : VWA (HMM E-Value=2.3e-32) Length = 318 Score = 29.9 bits (64), Expect = 2.1 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 262 STGGHYRCQCPSGVTGKHC 206 S+G Y C C +G TGK+C Sbjct: 76 SSGSDYTCACAAGYTGKNC 94 >SB_10656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1931 Score = 29.9 bits (64), Expect = 2.1 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = -3 Query: 274 SIVGSTGGHYRCQCPSGVTGKHCDVIPA---NMTTTEASTVQEFTVEVITDDGSAEN 113 S+ STG RC C +GVTG CD A N+ T S + ++D ++ N Sbjct: 785 SVCDSTG---RCLCKAGVTGIRCDTCAAGYFNLDNTNPSGCTQCWCSGLSDKCTSSN 838 >SB_59261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5445 Score = 29.9 bits (64), Expect = 2.1 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCDVI 197 G Y C C +G TGK C+++ Sbjct: 511 GDYSCACHTGFTGKDCEIV 529 Score = 29.5 bits (63), Expect = 2.7 Identities = 19/69 (27%), Positives = 29/69 (42%), Gaps = 1/69 (1%) Frame = -3 Query: 262 STGGHYRCQCPSGVTGKHCDVIPANMTTTEASTVQEFTVEV-ITDDGSAENTSDKTTTVA 86 ++ G + C+CP G+ G C NM T+ V IT+DG T + Sbjct: 804 NSDGGFTCKCPQGIKGDRCQY---NMGETKFDLVIMIDGSTSITEDGFRNAVDFATNFTS 860 Query: 85 EPNIDENET 59 + EN+T Sbjct: 861 LFTVAENKT 869 Score = 29.1 bits (62), Expect = 3.6 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 247 YRCQCPSGVTGKHCD 203 Y C+CP +GKHCD Sbjct: 2268 YSCECPLVYSGKHCD 2282 >SB_26480| Best HMM Match : EGF (HMM E-Value=0) Length = 1772 Score = 29.9 bits (64), Expect = 2.1 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 Query: 247 YRCQCPSGVTGKHCD 203 Y C CP+G TGK+C+ Sbjct: 1133 YTCACPAGYTGKNCE 1147 >SB_21404| Best HMM Match : VWA (HMM E-Value=8.1e-27) Length = 267 Score = 29.9 bits (64), Expect = 2.1 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 262 STGGHYRCQCPSGVTGKHC 206 S+G Y C C +G TGK+C Sbjct: 20 SSGSDYTCACAAGYTGKNC 38 >SB_2152| Best HMM Match : EGF (HMM E-Value=0) Length = 1603 Score = 29.9 bits (64), Expect = 2.1 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDV 200 + C CP+G TGK CD+ Sbjct: 388 FTCACPTGYTGKTCDI 403 >SB_58558| Best HMM Match : EGF (HMM E-Value=0) Length = 1101 Score = 29.5 bits (63), Expect = 2.7 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDV 200 YRCQC G GK+C + Sbjct: 181 YRCQCTQGFVGKNCQI 196 Score = 28.3 bits (60), Expect = 6.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C C +G TG HC+ Sbjct: 675 GGYTCTCAAGYTGLHCE 691 Score = 27.9 bits (59), Expect = 8.4 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -3 Query: 241 CQCPSGVTGKHC 206 CQCP G TGK+C Sbjct: 222 CQCPKGWTGKNC 233 >SB_39510| Best HMM Match : VWA (HMM E-Value=0) Length = 705 Score = 29.5 bits (63), Expect = 2.7 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 256 GGHYRCQCPSGVTGKHC 206 GG Y C+C +G GK+C Sbjct: 96 GGSYSCECSTGYVGKNC 112 >SB_33162| Best HMM Match : EGF (HMM E-Value=1.2e-06) Length = 313 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/21 (52%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -3 Query: 262 STGGH-YRCQCPSGVTGKHCD 203 +TGG Y C CP G+ G+ CD Sbjct: 107 ATGGFLYTCACPGGLKGEKCD 127 >SB_27922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1704 Score = 29.5 bits (63), Expect = 2.7 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDVIPANMT 182 YRC C +GVTG++C+ + T Sbjct: 1604 YRCICLTGVTGENCETVTNKCT 1625 >SB_26578| Best HMM Match : EGF (HMM E-Value=2.2e-35) Length = 136 Score = 29.5 bits (63), Expect = 2.7 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C C SG TGK+C+ Sbjct: 4 GAYSCTCKSGFTGKNCE 20 Score = 28.3 bits (60), Expect = 6.3 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C C +G TGK+C+ Sbjct: 80 GGYSCACKAGFTGKNCE 96 Score = 28.3 bits (60), Expect = 6.3 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C C +G TGK+C+ Sbjct: 118 GGYSCACKAGFTGKNCE 134 >SB_5768| Best HMM Match : EGF (HMM E-Value=3.5e-06) Length = 270 Score = 29.5 bits (63), Expect = 2.7 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 247 YRCQCPSGVTGKHCD 203 YRC+CP G TG C+ Sbjct: 203 YRCECPQGYTGAACE 217 >SB_1374| Best HMM Match : PAN (HMM E-Value=0.013) Length = 498 Score = 29.5 bits (63), Expect = 2.7 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 250 HYRCQCPSGVTGKHCDV 200 ++RC C + +TG HCD+ Sbjct: 132 NHRCMCKANLTGAHCDI 148 >SB_16758| Best HMM Match : EGF_CA (HMM E-Value=5.5e-14) Length = 338 Score = 29.5 bits (63), Expect = 2.7 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 247 YRCQCPSGVTGKHCD 203 YRC+CP G TG C+ Sbjct: 142 YRCECPQGYTGAACE 156 >SB_6200| Best HMM Match : Laminin_EGF (HMM E-Value=0) Length = 683 Score = 29.5 bits (63), Expect = 2.7 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 244 RCQCPSGVTGKHCD 203 +CQC SGVTG+ CD Sbjct: 268 QCQCKSGVTGRACD 281 >SB_58780| Best HMM Match : VWA (HMM E-Value=1.3e-34) Length = 264 Score = 29.1 bits (62), Expect = 3.6 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 247 YRCQCPSGVTGKHCD 203 Y C+CP +GKHCD Sbjct: 25 YSCECPLVYSGKHCD 39 >SB_58279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 744 Score = 29.1 bits (62), Expect = 3.6 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = -3 Query: 211 HCDVIPANMTTTEASTVQEFTVEVITDDGSAENTSDKTTTVAEP 80 HC P +TT S + +T VI +D A+NT ++T+ A P Sbjct: 600 HC---PKVLTTEHRSKLSRYTCLVILEDLIAQNTYNRTSNEAFP 640 >SB_38959| Best HMM Match : EGF (HMM E-Value=0.14) Length = 177 Score = 29.1 bits (62), Expect = 3.6 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCDV 200 G Y C CP G G C++ Sbjct: 147 GQYECACPKGFNGSRCEI 164 >SB_29518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 29.1 bits (62), Expect = 3.6 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCDV 200 G Y C CP G G C++ Sbjct: 3 GQYECACPKGFNGSRCEI 20 >SB_21308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2641 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -3 Query: 241 CQCPSGVTGKHCDVIPANMTTTE 173 CQCP+G TG +C PA + E Sbjct: 2352 CQCPAGHTGANCQEDPATDSVCE 2374 >SB_14925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 367 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -3 Query: 280 TMSIVGSTGGHYRCQCPSGVTGKHCD 203 T + G T + C CPSG TG C+ Sbjct: 72 TTCVPGPTQDTHTCACPSGYTGVDCE 97 >SB_2600| Best HMM Match : Fibrinogen_C (HMM E-Value=0.00053) Length = 260 Score = 29.1 bits (62), Expect = 3.6 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDVIP 194 Y+C C G TG+HC+ P Sbjct: 23 YQCNCRPGYTGRHCEKEP 40 >SB_57511| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 879 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 262 STGGHYRCQCPSGVTGKHCD 203 +T G Y C C G TGK CD Sbjct: 627 NTVGDYSCACVQGWTGKDCD 646 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 262 STGGHYRCQCPSGVTGKHCD 203 +T G Y C C G TGK CD Sbjct: 741 NTVGDYSCACVQGWTGKDCD 760 >SB_55021| Best HMM Match : EGF_CA (HMM E-Value=1.4013e-45) Length = 348 Score = 29.1 bits (62), Expect = 3.6 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -3 Query: 262 STGGHYRCQCPSGVTGKH 209 +T G Y+C+CPSG++ H Sbjct: 129 NTPGSYKCECPSGMSYNH 146 >SB_45836| Best HMM Match : EGF (HMM E-Value=6.7e-21) Length = 1332 Score = 29.1 bits (62), Expect = 3.6 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDV 200 + C+CP+G TG+ C+V Sbjct: 408 FSCRCPAGYTGRRCEV 423 >SB_42216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 745 Score = 29.1 bits (62), Expect = 3.6 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCDVIPA 191 G + C C G TG+ C+++P+ Sbjct: 60 GDFTCACQPGYTGRFCEIMPS 80 >SB_35194| Best HMM Match : EGF_2 (HMM E-Value=0) Length = 960 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -3 Query: 241 CQCPSGVTGKHCDVI 197 C CP G GK+CDVI Sbjct: 884 CTCPVGYKGKYCDVI 898 >SB_32355| Best HMM Match : Laminin_EGF (HMM E-Value=0) Length = 1358 Score = 29.1 bits (62), Expect = 3.6 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 3/60 (5%) Frame = -3 Query: 244 RCQCPSGVTGKHCDVIPA---NMTTTEASTVQEFTVEVITDDGSAENTSDKTTTVAEPNI 74 +C C GVTG+ CD N+TTT S + ++ + N S T VA+ N+ Sbjct: 1118 QCHCKPGVTGRKCDQCQQGFYNLTTTGCSAKVNVSHDMTL--VAKVNVSHDMTLVAKVNV 1175 >SB_24499| Best HMM Match : Fibrinogen_C (HMM E-Value=0.00053) Length = 274 Score = 29.1 bits (62), Expect = 3.6 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDVIP 194 Y+C C G TG+HC+ P Sbjct: 37 YQCNCRPGYTGRHCEKEP 54 >SB_24275| Best HMM Match : OGFr_III (HMM E-Value=8e-05) Length = 323 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/50 (28%), Positives = 23/50 (46%) Frame = -3 Query: 232 PSGVTGKHCDVIPANMTTTEASTVQEFTVEVITDDGSAENTSDKTTTVAE 83 PSG +G D +T T + T+ + ITD S T ++T+ + Sbjct: 165 PSGTSGTMTDTPSGTITDTSSGTITDTPSGTITDTPSGTITDTPSSTITD 214 >SB_23589| Best HMM Match : OGFr_III (HMM E-Value=8e-05) Length = 323 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/50 (28%), Positives = 23/50 (46%) Frame = -3 Query: 232 PSGVTGKHCDVIPANMTTTEASTVQEFTVEVITDDGSAENTSDKTTTVAE 83 PSG +G D +T T + T+ + ITD S T ++T+ + Sbjct: 165 PSGTSGTMTDTPSGTITDTSSGTITDTPSGTITDTPSGTITDTPSSTITD 214 >SB_15637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 731 Score = 29.1 bits (62), Expect = 3.6 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -3 Query: 250 HYRCQCPSGVTGKHCDVIP 194 +Y C C +G TG+HC+ P Sbjct: 140 NYTCACHAGYTGRHCEEPP 158 >SB_10956| Best HMM Match : EGF (HMM E-Value=5.3e-05) Length = 130 Score = 29.1 bits (62), Expect = 3.6 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCDVIPA 191 G + C C G TG+ C+++P+ Sbjct: 21 GDFTCACQPGYTGRFCEIMPS 41 >SB_7993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 676 Score = 29.1 bits (62), Expect = 3.6 Identities = 17/41 (41%), Positives = 22/41 (53%) Frame = -3 Query: 190 NMTTTEASTVQEFTVEVITDDGSAENTSDKTTTVAEPNIDE 68 N TTE S VQE + T + +A+ TSDK T E +E Sbjct: 519 NSETTE-SNVQEEGKSMETSESAAQGTSDKDATKVESETNE 558 >SB_3578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 355 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 Query: 262 STGGHYRCQCPSGVTGKHCDV 200 S G Y+C+CP G G+ C V Sbjct: 334 SNEGQYKCKCPPGYGGRDCYV 354 >SB_3456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 462 Score = 29.1 bits (62), Expect = 3.6 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 256 GGHYRCQCPSGVTGKHCD 203 G + CQC G +GKHC+ Sbjct: 263 GTQHSCQCARGYSGKHCE 280 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 312 EDHPDTCKNGGQCQSLEAQ 256 E PDTCKNGG C EAQ Sbjct: 80 ECDPDTCKNGGTCTE-EAQ 97 >SB_57139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 854 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 280 TMSIVGSTGGHYRCQCPSG 224 T IVG G Y CQCP G Sbjct: 769 TQCIVGDAPGIYSCQCPDG 787 >SB_18560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1937 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -3 Query: 265 GSTGGHYRCQCPSGVTGKHCDVI-PANMTTTEASTVQEFTV 146 GS + C+CP G +GK C A++ T+ ++VQ ++ Sbjct: 1414 GSCVENNGCECPKGFSGKRCQWYGDASLIFTKGNSVQRMSL 1454 >SB_4940| Best HMM Match : DUF755 (HMM E-Value=2.3) Length = 173 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = -3 Query: 250 HYRCQCPSGV--TGKHCDVIPANMTTTEASTVQEFTVEVIT 134 HYRCQC + T +IP N++TT +T + ++T Sbjct: 85 HYRCQCTHYIINTNATTIIIPNNISTTITTTTITAIIIIMT 125 >SB_45116| Best HMM Match : EGF (HMM E-Value=0) Length = 2023 Score = 28.7 bits (61), Expect = 4.8 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -3 Query: 244 RCQCPSGVTGKHCDVI 197 RC+C +G TG+HC+ I Sbjct: 148 RCRCVAGYTGEHCEEI 163 >SB_16746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 613 Score = 28.7 bits (61), Expect = 4.8 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 256 GGHYRCQCPSGVTGKHCD 203 GG Y C C SG TG +C+ Sbjct: 169 GGLYGCTCASGYTGANCE 186 >SB_8425| Best HMM Match : EGF (HMM E-Value=0) Length = 1955 Score = 28.7 bits (61), Expect = 4.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 247 YRCQCPSGVTGKHCD 203 +RC CP G TG+ C+ Sbjct: 454 FRCACPGGFTGRRCE 468 >SB_56964| Best HMM Match : Zona_pellucida (HMM E-Value=0) Length = 908 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -3 Query: 274 SIVGSTGGHYRCQCPSGVTGKHCD 203 S+ GS G Y C C G TGK+C+ Sbjct: 205 SVDGS--GDYNCACRPGFTGKNCE 226 >SB_44403| Best HMM Match : EGF (HMM E-Value=0.053) Length = 93 Score = 28.3 bits (60), Expect = 6.3 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C CP+G G C+ Sbjct: 51 GQYECACPAGFNGSRCE 67 >SB_42051| Best HMM Match : EGF_CA (HMM E-Value=6.9e-35) Length = 398 Score = 28.3 bits (60), Expect = 6.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 262 STGGHYRCQCPSGVTGKHC 206 +T G Y+C CP G GK+C Sbjct: 320 NTYGSYQCLCPVGKYGKNC 338 >SB_22511| Best HMM Match : EGF (HMM E-Value=0.053) Length = 120 Score = 28.3 bits (60), Expect = 6.3 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C CP+G G C+ Sbjct: 90 GQYECACPAGFNGSRCE 106 >SB_20919| Best HMM Match : WSC (HMM E-Value=1.1e-12) Length = 531 Score = 28.3 bits (60), Expect = 6.3 Identities = 18/66 (27%), Positives = 31/66 (46%), Gaps = 2/66 (3%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDVIPANMTTTEASTVQEFTVEVITDDGSAENTSDKTT--TVAEPNI 74 YRC+C S TG++C V + E V+ + S+E +K+T ++ E Sbjct: 324 YRCKCTSDFTGRNCQV---SKPDAENPIVKRTKIPRAEKKLSSEKYQEKSTGSSLTEKQR 380 Query: 73 DENETE 56 DE + + Sbjct: 381 DEKKED 386 >SB_8544| Best HMM Match : EGF (HMM E-Value=0.053) Length = 93 Score = 28.3 bits (60), Expect = 6.3 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C CP+G G C+ Sbjct: 51 GQYECACPAGFNGSRCE 67 >SB_6365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1017 Score = 28.3 bits (60), Expect = 6.3 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C CP G TG C+ Sbjct: 679 GQYYCTCPVGFTGNRCE 695 >SB_57080| Best HMM Match : EGF_CA (HMM E-Value=1.4013e-43) Length = 360 Score = 28.3 bits (60), Expect = 6.3 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 247 YRCQCPSGVTGKHCD 203 Y C C G TGKHC+ Sbjct: 130 YICSCTPGYTGKHCE 144 >SB_56451| Best HMM Match : EGF (HMM E-Value=0.053) Length = 205 Score = 28.3 bits (60), Expect = 6.3 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C CP+G G C+ Sbjct: 90 GQYECACPAGFNGSRCE 106 >SB_55780| Best HMM Match : EGF (HMM E-Value=0.053) Length = 209 Score = 28.3 bits (60), Expect = 6.3 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C CP+G G C+ Sbjct: 98 GQYECACPAGFNGSRCE 114 >SB_53139| Best HMM Match : EGF (HMM E-Value=3.2e-08) Length = 221 Score = 28.3 bits (60), Expect = 6.3 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C CP+G G C+ Sbjct: 51 GQYECACPAGFNGSRCE 67 >SB_49785| Best HMM Match : EGF (HMM E-Value=0.00078) Length = 261 Score = 28.3 bits (60), Expect = 6.3 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C CP+G G C+ Sbjct: 187 GQYECACPAGFNGSRCE 203 >SB_44311| Best HMM Match : EGF (HMM E-Value=0.048) Length = 266 Score = 28.3 bits (60), Expect = 6.3 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C CP+G G C+ Sbjct: 224 GQYECACPAGFNGSRCE 240 >SB_41738| Best HMM Match : EGF (HMM E-Value=0.053) Length = 198 Score = 28.3 bits (60), Expect = 6.3 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C CP+G G C+ Sbjct: 157 GQYECACPAGFNGSRCE 173 >SB_24013| Best HMM Match : EGF (HMM E-Value=0.053) Length = 93 Score = 28.3 bits (60), Expect = 6.3 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C CP+G G C+ Sbjct: 51 GQYECACPAGFNGSRCE 67 >SB_24004| Best HMM Match : EGF (HMM E-Value=5.7e-14) Length = 808 Score = 28.3 bits (60), Expect = 6.3 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCDV 200 G Y C CP G G C++ Sbjct: 651 GQYECACPKGFNGSRCEM 668 >SB_1588| Best HMM Match : EGF (HMM E-Value=0.053) Length = 209 Score = 28.3 bits (60), Expect = 6.3 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 Query: 253 GHYRCQCPSGVTGKHCD 203 G Y C CP+G G C+ Sbjct: 98 GQYECACPAGFNGSRCE 114 >SB_49120| Best HMM Match : F5_F8_type_C (HMM E-Value=1.1e-08) Length = 401 Score = 27.9 bits (59), Expect = 8.4 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -3 Query: 265 GSTGGHYRCQCPSGVTGKHCDVI 197 G+TG +CQC G TG+ CD + Sbjct: 135 GNTG---KCQCEPGFTGETCDTV 154 >SB_42355| Best HMM Match : EGF (HMM E-Value=2.9e-05) Length = 241 Score = 27.9 bits (59), Expect = 8.4 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = -3 Query: 274 SIVGSTGGHYRCQCPSGVTGKHCDVIPANMTTTEAS 167 S V + Y C C S GK+CD + ++ E++ Sbjct: 171 SCVTAGANAYNCTCTSNYMGKNCDDLKSSSVACEST 206 >SB_28657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3296 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = -3 Query: 190 NMTTTEASTVQEFTVEVITDDGSAENTSDKTTTVAEP 80 +MTTT ++T T ++ +GS+ T+ +TTT EP Sbjct: 385 SMTTTSSTT----TTSSLSSEGSSSATTPETTTPTEP 417 >SB_24529| Best HMM Match : Lectin_C (HMM E-Value=3.4e-27) Length = 644 Score = 27.9 bits (59), Expect = 8.4 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 9/60 (15%) Frame = -3 Query: 280 TMSIVGSTGGHYRCQCPSG--VTGKHCDVI-------PANMTTTEASTVQEFTVEVITDD 128 T++ +T G Y C CP+G V+G C+ + ++ T A+TV +T+ + D Sbjct: 388 TLATCVNTPGSYTCACPAGYTVSGHRCNDVNECGVSDRCHVNATCANTVGSYTLLALDSD 447 >SB_22536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 593 Score = 27.9 bits (59), Expect = 8.4 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -3 Query: 250 HYRCQCPSGVTGKHCDVIPANMTT 179 ++ C+CP+G TG+ C A+ T Sbjct: 400 YFHCECPAGFTGQTCSAEHAHAHT 423 >SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 2411 Score = 27.9 bits (59), Expect = 8.4 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -3 Query: 247 YRCQCPSGVTGKHCDV 200 YRC+C +G TG C++ Sbjct: 2220 YRCECRTGFTGSRCEL 2235 >SB_786| Best HMM Match : EGF (HMM E-Value=0) Length = 1427 Score = 27.9 bits (59), Expect = 8.4 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 247 YRCQCPSGVTGKHCD 203 Y+C C SG GK+CD Sbjct: 256 YKCVCHSGFVGKNCD 270 >SB_54456| Best HMM Match : EGF (HMM E-Value=2.3e-31) Length = 491 Score = 27.9 bits (59), Expect = 8.4 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -3 Query: 262 STGGHYRCQCPSGVTGKHCDV 200 + G YRC C G G CD+ Sbjct: 366 AVGNEYRCVCALGYKGDRCDI 386 >SB_39527| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 741 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/50 (28%), Positives = 26/50 (52%) Frame = +3 Query: 270 IDIVHRFCMYQDGLHSNLVLEIYIFIEFSVELLSLXEFVDCLFSLSKSYR 419 I +VH F +N+V+ ++ FI F E+ L E ++ + + +YR Sbjct: 544 IAVVHPFSHIPFTRQTNIVIALFWFIPFLTEIPHLFELLNVIVISTLAYR 593 >SB_18365| Best HMM Match : EGF (HMM E-Value=0.00021) Length = 188 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -3 Query: 265 GSTGGHYRCQCPSGVTGKHCDVIPA 191 G+TG +CQC G TG+ C+ PA Sbjct: 135 GNTG---KCQCGPGFTGETCETEPA 156 >SB_16968| Best HMM Match : Laminin_EGF (HMM E-Value=0) Length = 1101 Score = 27.9 bits (59), Expect = 8.4 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -3 Query: 244 RCQCPSGVTGKHCD 203 +CQC GVTG+ CD Sbjct: 748 KCQCKPGVTGRTCD 761 >SB_4118| Best HMM Match : EGF (HMM E-Value=1.8e-20) Length = 339 Score = 27.9 bits (59), Expect = 8.4 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 247 YRCQCPSGVTGKHCD 203 YRC CP G GK C+ Sbjct: 22 YRCTCPKGYIGKLCE 36 >SB_3431| Best HMM Match : EGF (HMM E-Value=1.8e-08) Length = 480 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/24 (50%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -1 Query: 342 KYIFP-ELNYCEDHPDTCKNGGQC 274 +Y P E+N C+ P CKNGG C Sbjct: 187 QYFVPNEINECDSSP--CKNGGNC 208 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,520,011 Number of Sequences: 59808 Number of extensions: 464295 Number of successful extensions: 2202 Number of sequences better than 10.0: 115 Number of HSP's better than 10.0 without gapping: 1328 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2192 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -