BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0124 (700 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC663.01c |ekc1|SPCC777.16c|protein phosphatase regulatory sub... 26 4.5 SPBC11C11.05 |||KRE9 family cell wall biosynthesis protein |Schi... 26 6.0 SPCC31H12.07 |sec231|sec23a, SPCC5E4.01|GTPase activating protei... 25 7.9 >SPCC663.01c |ekc1|SPCC777.16c|protein phosphatase regulatory subunit Ekc1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 838 Score = 26.2 bits (55), Expect = 4.5 Identities = 11/44 (25%), Positives = 20/44 (45%) Frame = -1 Query: 673 WNILPCSPDLGSSDFYVFSRLKEHLRGHKFEDDDAIVAAVDGFL 542 W+ L L F+++ EH K E+ A + ++D F+ Sbjct: 120 WSFLDSEGPLNPLQASYFAKVNEHFLDKKTEETVAFIQSIDNFV 163 >SPBC11C11.05 |||KRE9 family cell wall biosynthesis protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 284 Score = 25.8 bits (54), Expect = 6.0 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +3 Query: 288 YSTYYFVSALPRLFLSYQIYFSSTILGVF 374 Y+ ++ V+ L F +Y+IY S LGV+ Sbjct: 120 YTDFFTVNGLTGTFDNYEIYASLMALGVY 148 >SPCC31H12.07 |sec231|sec23a, SPCC5E4.01|GTPase activating protein Sec23a|Schizosaccharomyces pombe|chr 3|||Manual Length = 759 Score = 25.4 bits (53), Expect = 7.9 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 121 AN*RHPLRTQRSRLSVQIQMIQTACP 44 AN R P R + L++ + M+++ CP Sbjct: 251 ANDRRPQRCTGTALNISVSMMESVCP 276 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,599,712 Number of Sequences: 5004 Number of extensions: 46650 Number of successful extensions: 89 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 86 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -