BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0124 (700 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40437| Best HMM Match : VapD_N (HMM E-Value=2.4) 51 8e-07 SB_10010| Best HMM Match : HLH (HMM E-Value=8.5e-09) 37 0.014 >SB_40437| Best HMM Match : VapD_N (HMM E-Value=2.4) Length = 89 Score = 51.2 bits (117), Expect = 8e-07 Identities = 21/39 (53%), Positives = 29/39 (74%), Gaps = 1/39 (2%) Frame = +1 Query: 31 FQGIMDKLFESFE-SVPTNDFAEFSAGVFNWLEEYCKPQ 144 F+ I+D F +F+ +V NDF S+G+F+WLEEYCKPQ Sbjct: 51 FKAILDNQFVTFDGTVVVNDFDSLSSGIFHWLEEYCKPQ 89 >SB_10010| Best HMM Match : HLH (HMM E-Value=8.5e-09) Length = 227 Score = 37.1 bits (82), Expect = 0.014 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 1/55 (1%) Frame = +1 Query: 31 FQGIMDKLFESFES-VPTNDFAEFSAGVFNWLEEYCKPQSLRTMVHGVXRDQNYT 192 F ++ +LFES+ S V T + EF V WL+++C SLR V RD + T Sbjct: 125 FSVLLRQLFESYNSSVSTTNPEEFCRTVLAWLDQHCTLPSLRPAVLAALRDISRT 179 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,460,834 Number of Sequences: 59808 Number of extensions: 313135 Number of successful extensions: 597 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 587 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 597 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -