BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0123 (695 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0048 - 14441540-14441620,14442044-14442111,14442275-144424... 29 4.7 >10_08_0048 - 14441540-14441620,14442044-14442111,14442275-14442493, 14442506-14444508,14447541-14448410,14448533-14448576, 14449920-14450093 Length = 1152 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -1 Query: 578 GFPRNSFVNKYITGTSPRCTTAYLSDEIKIIQNA 477 G PR S ++K ITG + C +L+ ++ +A Sbjct: 473 GVPRKSVLSKLITGFAETCDAHWLNQSYNVVNHA 506 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,287,942 Number of Sequences: 37544 Number of extensions: 371297 Number of successful extensions: 519 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 512 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 519 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1780264028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -