BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0122 (705 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23352| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_51581| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_5648| Best HMM Match : rve (HMM E-Value=6.1e-13) 29 3.7 SB_20151| Best HMM Match : rve (HMM E-Value=2.9e-12) 29 4.9 SB_59748| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_51132| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_35010| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_27589| Best HMM Match : rve (HMM E-Value=1.5e-11) 28 6.4 SB_19980| Best HMM Match : rve (HMM E-Value=0.91) 28 6.4 SB_12137| Best HMM Match : rve (HMM E-Value=0.00054) 28 6.4 SB_9088| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_5506| Best HMM Match : rve (HMM E-Value=0.00062) 28 6.4 SB_3855| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_3086| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_1329| Best HMM Match : rve (HMM E-Value=1.7e-16) 28 6.4 SB_58507| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_50846| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_50079| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_49575| Best HMM Match : Laminin_G_2 (HMM E-Value=4.2) 28 6.4 SB_47817| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_41457| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_35447| Best HMM Match : rve (HMM E-Value=9.8e-20) 28 6.4 SB_23285| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_15622| Best HMM Match : Pec_lyase_N (HMM E-Value=2.9) 28 6.4 SB_24051| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_1255| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 >SB_23352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1830 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/32 (46%), Positives = 23/32 (71%) Frame = +1 Query: 457 LYLCLLPVVFSVASGLKYNDSKEVFTSKTLQT 552 L+ LLPVV+SV+ +YN E+FT ++LQ+ Sbjct: 1489 LHATLLPVVYSVSFDSRYN---ELFTGRSLQS 1517 >SB_51581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 221 Score = 29.5 bits (63), Expect = 2.8 Identities = 15/32 (46%), Positives = 23/32 (71%) Frame = +1 Query: 457 LYLCLLPVVFSVASGLKYNDSKEVFTSKTLQT 552 L LLPVV+SV++ +YN E+FT ++LQ+ Sbjct: 66 LCAALLPVVYSVSNESRYN---ELFTGRSLQS 94 >SB_5648| Best HMM Match : rve (HMM E-Value=6.1e-13) Length = 1606 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/32 (46%), Positives = 23/32 (71%) Frame = +1 Query: 457 LYLCLLPVVFSVASGLKYNDSKEVFTSKTLQT 552 L + LLPVV+SV+ +YN E+FT ++LQ+ Sbjct: 1364 LRVTLLPVVYSVSLDSRYN---ELFTGRSLQS 1392 >SB_20151| Best HMM Match : rve (HMM E-Value=2.9e-12) Length = 438 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = +1 Query: 457 LYLCLLPVVFSVASGLKYNDSKEVFTSKTLQT 552 L LLPVV+SV+ +YN E+FT ++LQ+ Sbjct: 373 LCAALLPVVYSVSLDSRYN---ELFTGRSLQS 401 >SB_59748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 420 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +1 Query: 469 LLPVVFSVASGLKYNDSKEVFTSKTLQT 552 LLPVV+SV+ +YN E+FT ++LQ+ Sbjct: 359 LLPVVYSVSLDSRYN---ELFTGRSLQS 383 >SB_51132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +1 Query: 469 LLPVVFSVASGLKYNDSKEVFTSKTLQT 552 LLPVV+SV+ +YN E+FT ++LQ+ Sbjct: 181 LLPVVYSVSLDSRYN---ELFTGRSLQS 205 >SB_35010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +1 Query: 469 LLPVVFSVASGLKYNDSKEVFTSKTLQT 552 LLPVV+SV+ +YN E+FT ++LQ+ Sbjct: 71 LLPVVYSVSLDSRYN---ELFTGRSLQS 95 >SB_27589| Best HMM Match : rve (HMM E-Value=1.5e-11) Length = 323 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +1 Query: 469 LLPVVFSVASGLKYNDSKEVFTSKTLQT 552 LLPVV+SV+ +YN E+FT ++LQ+ Sbjct: 262 LLPVVYSVSLDSRYN---ELFTGRSLQS 286 >SB_19980| Best HMM Match : rve (HMM E-Value=0.91) Length = 367 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +1 Query: 469 LLPVVFSVASGLKYNDSKEVFTSKTLQT 552 LLPVV+SV+ +YN E+FT ++LQ+ Sbjct: 306 LLPVVYSVSLDSRYN---ELFTGRSLQS 330 >SB_12137| Best HMM Match : rve (HMM E-Value=0.00054) Length = 338 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +1 Query: 469 LLPVVFSVASGLKYNDSKEVFTSKTLQT 552 LLPVV+SV+ +YN E+FT ++LQ+ Sbjct: 277 LLPVVYSVSLDSRYN---ELFTGRSLQS 301 >SB_9088| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 884 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +1 Query: 469 LLPVVFSVASGLKYNDSKEVFTSKTLQT 552 LLPVV+SV+ +YN E+FT ++LQ+ Sbjct: 835 LLPVVYSVSLDSRYN---ELFTGRSLQS 859 >SB_5506| Best HMM Match : rve (HMM E-Value=0.00062) Length = 390 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +1 Query: 469 LLPVVFSVASGLKYNDSKEVFTSKTLQT 552 LLPVV+SV+ +YN E+FT ++LQ+ Sbjct: 329 LLPVVYSVSLDSRYN---ELFTGRSLQS 353 >SB_3855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 994 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +1 Query: 469 LLPVVFSVASGLKYNDSKEVFTSKTLQT 552 LLPVV+SV+ +YN E+FT ++LQ+ Sbjct: 933 LLPVVYSVSLDSRYN---ELFTGRSLQS 957 >SB_3086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 59 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +2 Query: 446 PTHFCICVSYLSFFPLHPV*NTTILKKFSLQK 541 PT + + ++SF P+HP N T+L L+K Sbjct: 6 PTCTSVTLPFISFSPVHPPPNATVLTLTPLKK 37 >SB_1329| Best HMM Match : rve (HMM E-Value=1.7e-16) Length = 446 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +1 Query: 469 LLPVVFSVASGLKYNDSKEVFTSKTLQT 552 LLPVV+SV+ +YN E+FT ++LQ+ Sbjct: 385 LLPVVYSVSLDSRYN---ELFTGRSLQS 409 >SB_58507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2353 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +1 Query: 469 LLPVVFSVASGLKYNDSKEVFTSKTLQT 552 LLPVV+SV+ +YN E+FT ++LQ+ Sbjct: 162 LLPVVYSVSLDSRYN---ELFTGRSLQS 186 >SB_50846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +1 Query: 469 LLPVVFSVASGLKYNDSKEVFTSKTLQT 552 LLPVV+SV+ +YN E+FT ++LQ+ Sbjct: 180 LLPVVYSVSLDSRYN---ELFTGRSLQS 204 >SB_50079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 496 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +1 Query: 469 LLPVVFSVASGLKYNDSKEVFTSKTLQT 552 LLPVV+SV+ +YN E+FT ++LQ+ Sbjct: 435 LLPVVYSVSLDSRYN---ELFTGRSLQS 459 >SB_49575| Best HMM Match : Laminin_G_2 (HMM E-Value=4.2) Length = 580 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +1 Query: 469 LLPVVFSVASGLKYNDSKEVFTSKTLQT 552 LLPVV+SV+ +YN E+FT ++LQ+ Sbjct: 466 LLPVVYSVSLDSRYN---ELFTGRSLQS 490 >SB_47817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 693 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +1 Query: 469 LLPVVFSVASGLKYNDSKEVFTSKTLQT 552 LLPVV+SV+ +YN E+FT ++LQ+ Sbjct: 632 LLPVVYSVSLDSRYN---ELFTGRSLQS 656 >SB_41457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 545 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +1 Query: 469 LLPVVFSVASGLKYNDSKEVFTSKTLQT 552 LLPVV+SV+ +YN E+FT ++LQ+ Sbjct: 484 LLPVVYSVSLDSRYN---ELFTGRSLQS 508 >SB_35447| Best HMM Match : rve (HMM E-Value=9.8e-20) Length = 496 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +1 Query: 469 LLPVVFSVASGLKYNDSKEVFTSKTLQT 552 LLPVV+SV+ +YN E+FT ++LQ+ Sbjct: 382 LLPVVYSVSLDSRYN---ELFTGRSLQS 406 >SB_23285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 249 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +1 Query: 469 LLPVVFSVASGLKYNDSKEVFTSKTLQT 552 LLPVV+SV+ +YN E+FT ++LQ+ Sbjct: 204 LLPVVYSVSLDSRYN---ELFTGRSLQS 228 >SB_15622| Best HMM Match : Pec_lyase_N (HMM E-Value=2.9) Length = 511 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +1 Query: 469 LLPVVFSVASGLKYNDSKEVFTSKTLQT 552 LLPVV+SV+ +YN E+FT ++LQ+ Sbjct: 352 LLPVVYSVSLDSRYN---ELFTGRSLQS 376 >SB_24051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 889 Score = 27.9 bits (59), Expect = 8.5 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = +1 Query: 472 LPVVFSVASGLKYNDSKEVFTSKTLQT 552 LPVVFSV+ +YN E+FT ++LQ+ Sbjct: 829 LPVVFSVSLDSRYN---ELFTGRSLQS 852 >SB_1255| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 27.9 bits (59), Expect = 8.5 Identities = 13/28 (46%), Positives = 21/28 (75%) Frame = +1 Query: 469 LLPVVFSVASGLKYNDSKEVFTSKTLQT 552 LLPVV+S++ +YN E+FT ++LQ+ Sbjct: 172 LLPVVYSISLDSRYN---ELFTGRSLQS 196 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,038,183 Number of Sequences: 59808 Number of extensions: 428845 Number of successful extensions: 1084 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 1025 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1077 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -