BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0119 (536 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|... 54 2e-06 UniRef50_Q8D2I4 Cluster: PurU protein; n=1; Wigglesworthia gloss... 32 7.3 >UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth) Length = 191 Score = 54.0 bits (124), Expect = 2e-06 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = -2 Query: 112 LLLRWVDELTSQLVVKWLLEPIDIYNVNAPPTLRYKF 2 LLLRWVDELT+ LV+ P +Y+VNAPPT RYKF Sbjct: 155 LLLRWVDELTAHLVLSGYWSPRHLYDVNAPPTSRYKF 191 >UniRef50_Q8D2I4 Cluster: PurU protein; n=1; Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis|Rep: PurU protein - Wigglesworthia glossinidia brevipalpis Length = 289 Score = 32.3 bits (70), Expect = 7.3 Identities = 15/48 (31%), Positives = 30/48 (62%) Frame = -2 Query: 166 ENNRKNLTCITLLRKKYILLLRWVDELTSQLVVKWLLEPIDIYNVNAP 23 ++N K L I +L+ YI+L +++ LTS + K++ + I+I++ P Sbjct: 156 DHNNKILNIIQILKPDYIILAKYMRILTSSFIKKYINKIINIHHSILP 203 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 431,973,143 Number of Sequences: 1657284 Number of extensions: 7298727 Number of successful extensions: 15626 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15273 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15623 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 34156095254 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -