BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0119 (536 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 23 2.0 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 23 2.0 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 23 2.0 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 23 2.0 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 23 2.6 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 23 2.6 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 23 2.6 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 23 2.6 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 23 2.6 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 23 2.6 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 22 4.6 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 22 4.6 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 22 4.6 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 22 4.6 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 22 4.6 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 22 4.6 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 22 4.6 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 22 4.6 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 22 4.6 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 4.6 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 21 6.0 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 21 6.0 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 21 6.0 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 21 6.0 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 21 6.0 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 6.0 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 6.0 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 6.0 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 6.0 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 6.0 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 21 8.0 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 8.0 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 2.0 Identities = 16/60 (26%), Positives = 26/60 (43%) Frame = -2 Query: 199 SLSYRYKFSYYENNRKNLTCITLLRKKYILLLRWVDELTSQLVVKWLLEPIDIYNVNAPP 20 SLS YK+S Y N N +K + +++++ + P+ IY N PP Sbjct: 84 SLSNNYKYSNYNNYNNNNYNNNNYKKLQYYNINYIEQIPIPV-------PVPIYCGNFPP 136 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 2.0 Identities = 16/60 (26%), Positives = 26/60 (43%) Frame = -2 Query: 199 SLSYRYKFSYYENNRKNLTCITLLRKKYILLLRWVDELTSQLVVKWLLEPIDIYNVNAPP 20 SLS YK+S Y N N +K + +++++ + P+ IY N PP Sbjct: 84 SLSNNYKYSNYNNYNNNNYNNNNYKKLQYYNINYIEQIPIPV-------PVPIYCGNFPP 136 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 2.0 Identities = 16/60 (26%), Positives = 26/60 (43%) Frame = -2 Query: 199 SLSYRYKFSYYENNRKNLTCITLLRKKYILLLRWVDELTSQLVVKWLLEPIDIYNVNAPP 20 SLS YK+S Y N N +K + +++++ + P+ IY N PP Sbjct: 84 SLSNNYKYSNYNNYNNNNYNNNNYKKLQYYNINYIEQIPIPV-------PVPIYCGNFPP 136 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 2.0 Identities = 16/60 (26%), Positives = 26/60 (43%) Frame = -2 Query: 199 SLSYRYKFSYYENNRKNLTCITLLRKKYILLLRWVDELTSQLVVKWLLEPIDIYNVNAPP 20 SLS YK+S Y N N +K + +++++ + P+ IY N PP Sbjct: 84 SLSNNYKYSNYNNYNNNNYNNNNYKKLQYYNINYIEQIPIPV-------PVPIYCGNFPP 136 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.6 bits (46), Expect = 2.6 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -2 Query: 199 SLSYRYKFSYYENNRKNLTCITL 131 SLS Y +S Y NN C + Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNI 106 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.6 bits (46), Expect = 2.6 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -2 Query: 199 SLSYRYKFSYYENNRKNLTCITL 131 SLS Y +S Y NN C + Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNI 106 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.6 bits (46), Expect = 2.6 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -2 Query: 199 SLSYRYKFSYYENNRKNLTCITL 131 SLS Y +S Y NN C + Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNI 106 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.6 bits (46), Expect = 2.6 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -2 Query: 199 SLSYRYKFSYYENNRKNLTCITL 131 SLS Y +S Y NN C + Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNI 106 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.6 bits (46), Expect = 2.6 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -2 Query: 199 SLSYRYKFSYYENNRKNLTCITL 131 SLS Y +S Y NN C + Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNI 106 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.6 bits (46), Expect = 2.6 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -2 Query: 199 SLSYRYKFSYYENNRKNLTCITL 131 SLS Y +S Y NN C + Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNI 106 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 4.6 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -2 Query: 199 SLSYRYKFSYYENNRKN 149 SLS YK+S Y N N Sbjct: 84 SLSNNYKYSNYNNYNNN 100 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 4.6 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -2 Query: 199 SLSYRYKFSYYENNRKN 149 SLS YK+S Y N N Sbjct: 84 SLSNNYKYSNYNNYNNN 100 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 4.6 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -2 Query: 199 SLSYRYKFSYYENNRKN 149 SLS YK+S Y N N Sbjct: 84 SLSNNYKYSNYNNYNNN 100 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 4.6 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -2 Query: 199 SLSYRYKFSYYENNRKN 149 SLS YK+S Y N N Sbjct: 84 SLSNNYKYSNYNNYNNN 100 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 4.6 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -2 Query: 199 SLSYRYKFSYYENNRKN 149 SLS YK+S Y N N Sbjct: 84 SLSNNYKYSNYNNYNNN 100 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 4.6 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -2 Query: 199 SLSYRYKFSYYENNRKN 149 SLS YK+S Y N N Sbjct: 84 SLSNNYKYSNYNNYNNN 100 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 4.6 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -2 Query: 199 SLSYRYKFSYYENNRKN 149 SLS YK+S Y N N Sbjct: 84 SLSNNYKYSNYNNYNNN 100 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 4.6 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -2 Query: 199 SLSYRYKFSYYENNRKN 149 SLS YK+S Y N N Sbjct: 84 SLSNNYKYSNYNNYNNN 100 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 4.6 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -2 Query: 199 SLSYRYKFSYYENNRKN 149 SLS YK+S Y N N Sbjct: 84 SLSNNYKYSNYNNYNNN 100 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.8 bits (44), Expect = 4.6 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -2 Query: 199 SLSYRYKFSYYENNRKN 149 SLS YK+S Y N N Sbjct: 317 SLSNNYKYSNYNNYNNN 333 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.4 bits (43), Expect = 6.0 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 Query: 199 SLSYRYKFSYYENNRKNL 146 SLS Y ++ Y NN K L Sbjct: 84 SLSNNYNYNNYNNNYKPL 101 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.4 bits (43), Expect = 6.0 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 Query: 199 SLSYRYKFSYYENNRKNL 146 SLS Y ++ Y NN K L Sbjct: 84 SLSNNYNYNNYNNNYKPL 101 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.4 bits (43), Expect = 6.0 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 Query: 199 SLSYRYKFSYYENNRKNL 146 SLS Y ++ Y NN K L Sbjct: 84 SLSNNYNYNNYNNNYKPL 101 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.4 bits (43), Expect = 6.0 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 Query: 199 SLSYRYKFSYYENNRKNL 146 SLS Y ++ Y NN K L Sbjct: 84 SLSNNYNYNNYNNNYKPL 101 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.4 bits (43), Expect = 6.0 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 Query: 199 SLSYRYKFSYYENNRKNL 146 SLS Y ++ Y NN K L Sbjct: 317 SLSNNYNYNNYNNNYKPL 334 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 6.0 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 Query: 199 SLSYRYKFSYYENNRKNL 146 SLS Y ++ Y NN K L Sbjct: 317 SLSNNYNYNNYNNNYKPL 334 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 6.0 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 Query: 199 SLSYRYKFSYYENNRKNL 146 SLS Y ++ Y NN K L Sbjct: 317 SLSNNYNYNNYNNNYKPL 334 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 6.0 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 Query: 199 SLSYRYKFSYYENNRKNL 146 SLS Y ++ Y NN K L Sbjct: 317 SLSNNYNYNNYNNNYKPL 334 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 6.0 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 Query: 199 SLSYRYKFSYYENNRKNL 146 SLS Y ++ Y NN K L Sbjct: 317 SLSNNYNYNNYNNNYKPL 334 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.4 bits (43), Expect = 6.0 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 Query: 199 SLSYRYKFSYYENNRKNL 146 SLS Y ++ Y NN K L Sbjct: 306 SLSNNYNYNNYNNNYKPL 323 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 21.0 bits (42), Expect = 8.0 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 388 YIACGINENILVPSIFI 438 ++ CGI +ILVP ++ Sbjct: 368 HLVCGILGSILVPFFYV 384 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.0 bits (42), Expect = 8.0 Identities = 6/22 (27%), Positives = 15/22 (68%) Frame = -2 Query: 106 LRWVDELTSQLVVKWLLEPIDI 41 +R+ +L ++ +W++EP D+ Sbjct: 698 VRYTAKLQVKVPPRWIVEPTDV 719 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,409 Number of Sequences: 438 Number of extensions: 2658 Number of successful extensions: 33 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15213684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -