BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0117 (696 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22E12.18 |||conserved fungal protein|Schizosaccharomyces pom... 27 3.4 SPBC1683.12 |||nicotinic acid plasma membrane transporter |Schiz... 26 5.9 >SPAC22E12.18 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 336 Score = 26.6 bits (56), Expect = 3.4 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 22 GEILKVAIFWNSCTKIRKNGAMNI 93 G ++ I W SC KI K G+ I Sbjct: 148 GRLIDTGILWESCEKIEKLGSEGI 171 >SPBC1683.12 |||nicotinic acid plasma membrane transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 482 Score = 25.8 bits (54), Expect = 5.9 Identities = 13/49 (26%), Positives = 22/49 (44%) Frame = -1 Query: 246 TANCAGWSVLFLIMCSTKQYLALNNDRSISFTGVGAGLRCMSNIVKETY 100 +A GWS++ + C + Y +L R + G C+S + TY Sbjct: 113 SAMIIGWSLVTIFTCFVRHYWSLVLTRLLLGICEGGFFPCLSLYISMTY 161 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,769,763 Number of Sequences: 5004 Number of extensions: 55344 Number of successful extensions: 120 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 120 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 321151040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -