BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0116 (611 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT010009-1|AAQ22478.1| 2051|Drosophila melanogaster RE22882p pro... 30 2.8 AF106933-1|AAD09426.1| 2051|Drosophila melanogaster plexin B pro... 30 2.8 AE014135-2|AAF59374.2| 2051|Drosophila melanogaster CG17245-PA p... 30 2.8 >BT010009-1|AAQ22478.1| 2051|Drosophila melanogaster RE22882p protein. Length = 2051 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = -2 Query: 142 NNI--VNEALKKNYYMTLSFEFHRNLEFAG 59 NNI V ++ KNY+ +SF+F N+ FAG Sbjct: 73 NNIESVRDSQSKNYFTHMSFDFMHNVLFAG 102 >AF106933-1|AAD09426.1| 2051|Drosophila melanogaster plexin B protein. Length = 2051 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = -2 Query: 142 NNI--VNEALKKNYYMTLSFEFHRNLEFAG 59 NNI V ++ KNY+ +SF+F N+ FAG Sbjct: 73 NNIESVRDSQSKNYFTHMSFDFMHNVLFAG 102 >AE014135-2|AAF59374.2| 2051|Drosophila melanogaster CG17245-PA protein. Length = 2051 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = -2 Query: 142 NNI--VNEALKKNYYMTLSFEFHRNLEFAG 59 NNI V ++ KNY+ +SF+F N+ FAG Sbjct: 73 NNIESVRDSQSKNYFTHMSFDFMHNVLFAG 102 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,038,573 Number of Sequences: 53049 Number of extensions: 252695 Number of successful extensions: 291 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 291 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 291 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2497240350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -