BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0113 (620 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. 27 0.64 AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. 25 2.6 AY146748-1|AAO12063.1| 279|Anopheles gambiae odorant-binding pr... 24 3.4 AJ618922-1|CAF02001.1| 272|Anopheles gambiae odorant-binding pr... 23 5.9 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 23 5.9 >EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. Length = 661 Score = 26.6 bits (56), Expect = 0.64 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = -2 Query: 478 GRAHDPPVVKWLQKPIDIYNVNAAVQFETRVLRS 377 G HDP + Q P+++Y V +F R + + Sbjct: 257 GTYHDPKKNETTQTPLEVYTVRRGARFRFRFINA 290 >AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. Length = 461 Score = 24.6 bits (51), Expect = 2.6 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 221 RNRRVYDDRCIIIFCVVLLYYTYFYW 298 RNRR C + CVV++ + YW Sbjct: 166 RNRRDRQPCCSTLLCVVVVPFCCRYW 191 >AY146748-1|AAO12063.1| 279|Anopheles gambiae odorant-binding protein AgamOBP41 protein. Length = 279 Score = 24.2 bits (50), Expect = 3.4 Identities = 12/43 (27%), Positives = 19/43 (44%) Frame = +3 Query: 102 PIDIHNVNVPPTLRYKF*SLKYSYNGCXSLQTETHYCFTAEIG 230 P D +NVN T + +L+ + C L E+ C+ G Sbjct: 102 PADAYNVNRTETCLQELPALELNAEKCCGLAFESFLCYYYNYG 144 >AJ618922-1|CAF02001.1| 272|Anopheles gambiae odorant-binding protein OBPjj5a protein. Length = 272 Score = 23.4 bits (48), Expect = 5.9 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -1 Query: 395 DKSSKVSVLTDQRLFHLSNRNALLRSLTRRHTTSKN 288 +K +K + + FHL N R+ RR+ +S+N Sbjct: 129 EKFTKSECVNIRNNFHLPKSNRNCRTAARRNHSSRN 164 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 23.4 bits (48), Expect = 5.9 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +2 Query: 224 NRRVYDDRCIIIFCVVLLYYTYFYWSYDVW 313 NRRV DR I+C F+W VW Sbjct: 138 NRRV--DRFSKIYCCCHFSMATFFWFMPVW 165 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 651,558 Number of Sequences: 2352 Number of extensions: 12488 Number of successful extensions: 21 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60214320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -