BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0112 (643 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68317-4|CAA92688.1| 486|Caenorhabditis elegans Hypothetical pr... 31 0.70 Z81130-1|CAB03413.1| 168|Caenorhabditis elegans Hypothetical pr... 28 4.9 >Z68317-4|CAA92688.1| 486|Caenorhabditis elegans Hypothetical protein T01H3.4 protein. Length = 486 Score = 31.1 bits (67), Expect = 0.70 Identities = 13/44 (29%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = -2 Query: 549 FWVKLRKLYNLAYY--FKYNSCIHNCV*HFILYEYSDAILYKWR 424 F+ + L L Y F++ C++NCV H+ + D L+ W+ Sbjct: 427 FFNATKSLLMLGYKPNFEFKECVNNCVKHYREFRKKDVRLFSWQ 470 >Z81130-1|CAB03413.1| 168|Caenorhabditis elegans Hypothetical protein T23G11.1 protein. Length = 168 Score = 28.3 bits (60), Expect = 4.9 Identities = 22/58 (37%), Positives = 24/58 (41%), Gaps = 1/58 (1%) Frame = +3 Query: 33 NSVLRSQGHLLTMFA-GYYTCF*NRVKQNSFYFIFTSFFVSQ*EICISFYCRTAFSHF 203 NS LRS+G T A T N FTS VS + ISFY T S F Sbjct: 32 NSTLRSRGKASTRTALSTATAVENGPSYEKMISAFTSVAVSYFVLAISFYIETTVSLF 89 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,271,347 Number of Sequences: 27780 Number of extensions: 256661 Number of successful extensions: 587 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 571 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 587 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1427403330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -