BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0109 (636 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1031| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_48964| Best HMM Match : TRAP_240kDa (HMM E-Value=0) 28 7.3 >SB_1031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1933 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 275 LTLISQIPSKVHPSHFRTPPPHIT 346 + + QIP VHPS+ PPP+ T Sbjct: 1553 MNFLQQIPLGVHPSYPLPPPPYAT 1576 >SB_48964| Best HMM Match : TRAP_240kDa (HMM E-Value=0) Length = 1227 Score = 27.9 bits (59), Expect = 7.3 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = -3 Query: 610 IHLMVYTYVYYFFSIILNFTTTAYSPLPNARVH-L*ICA 497 +HL + + +Y FS++L+ T TAY + A V L +CA Sbjct: 902 VHLCILSQLYDAFSVLLDSTETAYLSVGCASVMCLGLCA 940 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,134,013 Number of Sequences: 59808 Number of extensions: 365367 Number of successful extensions: 833 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 778 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 831 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1596754500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -