BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0109 (636 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ278310-1|CAB93496.1| 219|Anopheles gambiae serine protease-li... 25 2.7 AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 23 8.1 >AJ278310-1|CAB93496.1| 219|Anopheles gambiae serine protease-like protein protein. Length = 219 Score = 24.6 bits (51), Expect = 2.7 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = +1 Query: 490 TLSHIFRGGLVHWAMGC 540 +++H ++ G+V W +GC Sbjct: 167 SVNHYYQAGMVAWGIGC 183 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 23.0 bits (47), Expect = 8.1 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -2 Query: 575 FLNHFKLYDYSLQPIAQCTSPPLNMCDRVRDAE 477 FL+ Y Y L + SP + C+ DAE Sbjct: 892 FLSSHGFYAYQLHRMQLTGSPLCDACEEPEDAE 924 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 633,661 Number of Sequences: 2352 Number of extensions: 11444 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62305095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -