BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0109 (636 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z29095-5|CAA82350.1| 289|Caenorhabditis elegans Hypothetical pr... 28 6.4 AJ005867-1|CAA06744.1| 289|Caenorhabditis elegans Sqv-3 protein... 28 6.4 >Z29095-5|CAA82350.1| 289|Caenorhabditis elegans Hypothetical protein R10E11.4 protein. Length = 289 Score = 27.9 bits (59), Expect = 6.4 Identities = 16/66 (24%), Positives = 30/66 (45%) Frame = +2 Query: 221 DRRTSYLFPFKLPHIISALTLISQIPSKVHPSHFRTPPPHITVYFHTQDLFDHMIILSTL 400 D T Y+ P L L +I +P + R PH++ + H Q++ H++I++ Sbjct: 35 DLMTDYVDPRPLQTSYHKLCVI--VPYRDRLEELREFSPHMSKFLHNQNVSHHILIINQT 92 Query: 401 SNICLN 418 + N Sbjct: 93 DPLRFN 98 >AJ005867-1|CAA06744.1| 289|Caenorhabditis elegans Sqv-3 protein protein. Length = 289 Score = 27.9 bits (59), Expect = 6.4 Identities = 16/66 (24%), Positives = 30/66 (45%) Frame = +2 Query: 221 DRRTSYLFPFKLPHIISALTLISQIPSKVHPSHFRTPPPHITVYFHTQDLFDHMIILSTL 400 D T Y+ P L L +I +P + R PH++ + H Q++ H++I++ Sbjct: 35 DLMTDYVDPRPLQTSYHKLCVI--VPYRDRLEELREFSPHMSKFLHNQNVSHHILIINQT 92 Query: 401 SNICLN 418 + N Sbjct: 93 DPLRFN 98 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,146,496 Number of Sequences: 27780 Number of extensions: 271406 Number of successful extensions: 724 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 706 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 724 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1406256614 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -