BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0108 (690 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0381 + 17128437-17128655,17129250-17129331,17129409-171295... 28 8.0 02_01_0296 + 1978565-1981197,1981216-1981639,1982280-1982771,198... 28 8.0 >09_04_0381 + 17128437-17128655,17129250-17129331,17129409-17129564, 17129646-17130431,17130743-17131094,17131467-17131548, 17131756-17131833,17132041-17132055 Length = 589 Score = 27.9 bits (59), Expect = 8.0 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = -1 Query: 654 EKSPTLPGTPSRDRTSNERVK*ESLSAVEP--LKISLGPRSASNIFRSSDP 508 E SP+LP T + + + ES S + P L+ +++ N+ RSS P Sbjct: 401 ESSPSLPSTQASVQDEQVGITEESASIITPIILRKDAATQTSPNLSRSSSP 451 >02_01_0296 + 1978565-1981197,1981216-1981639,1982280-1982771, 1982950-1983087 Length = 1228 Score = 27.9 bits (59), Expect = 8.0 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +3 Query: 558 FLGALPH*ATPILLSHLTSDLCSESQAK*GFFRDQHYTTTRLA 686 FLG P P ++SH + LC S+ G+ H+ T L+ Sbjct: 704 FLGLRPPKLFPCIVSHRQAMLCLSSRPWLGYIHQGHFLLTPLS 746 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,596,655 Number of Sequences: 37544 Number of extensions: 350814 Number of successful extensions: 769 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 752 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 769 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1756684372 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -