BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0107 (640 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U97549-9|AAB52849.2| 472|Caenorhabditis elegans Hypothetical pr... 28 4.9 U80439-8|AAB37646.3| 1724|Caenorhabditis elegans Hypothetical pr... 28 4.9 Z77652-13|CAB01120.2| 308|Caenorhabditis elegans Hypothetical p... 27 8.6 >U97549-9|AAB52849.2| 472|Caenorhabditis elegans Hypothetical protein F15A8.7 protein. Length = 472 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = +2 Query: 41 HASTLHREXXHQRSAPQDHRGRVRHAAPAGDRPRASYPRDPLI 169 H++T H H Q HR H AP R +A P +P + Sbjct: 429 HSATEHGAHNHSEHH-QLHRSIFHHGAPTSIRSQAQVPHNPFL 470 >U80439-8|AAB37646.3| 1724|Caenorhabditis elegans Hypothetical protein C01G8.9a protein. Length = 1724 Score = 28.3 bits (60), Expect = 4.9 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +2 Query: 38 RHASTL--HREXXHQRSAPQDHRGRVRHAAPAGDRPRASYPRDPLIP 172 +HA L ++ HQ+ Q H+ + + AP G RP YP P+ P Sbjct: 777 QHAQYLAWQQQRYHQQ---QQHQQQQQQGAPGGPRPPYPYPGGPVPP 820 >Z77652-13|CAB01120.2| 308|Caenorhabditis elegans Hypothetical protein C06B3.11 protein. Length = 308 Score = 27.5 bits (58), Expect = 8.6 Identities = 10/45 (22%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +3 Query: 444 SVEFREILSPRHTIVLESRVS--VPCYECLYICLYSFSITYKLMI 572 S+ + SP T+ + ++ VPC CL++ + +++ ++I Sbjct: 37 SLRIPSMKSPFGTLTINQNIAELVPCLACLFVFFFGYTLNLNIVI 81 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,659,755 Number of Sequences: 27780 Number of extensions: 209553 Number of successful extensions: 443 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 443 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1416829972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -