BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0105 (655 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_1159 + 26585042-26585441,26585520-26585608,26585670-265857... 29 4.3 >12_02_1159 + 26585042-26585441,26585520-26585608,26585670-26585720, 26586189-26586282,26586451-26586512,26586589-26586671, 26586793-26586901,26587010-26587051,26587152-26587316, 26588165-26588341,26588820-26588984,26589069-26589332 Length = 566 Score = 28.7 bits (61), Expect = 4.3 Identities = 12/47 (25%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = -2 Query: 213 ILDYSVLRRIVIQNIDKKH-LDRKIPIFAYFSETAKLGLIWNRSYVI 76 IL + +++Q+++ K +++K+ I+ Y + T L W +YV+ Sbjct: 341 ILSFCTHNYLIVQDVELKDVIEKKLNIYCYCNPTVVGELTWGLNYVL 387 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,951,905 Number of Sequences: 37544 Number of extensions: 279639 Number of successful extensions: 367 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 364 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 367 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1632177336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -