BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0104 (650 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC776.06c |||spindle pole body interacting protein |Schizosacc... 27 2.3 SPBC1734.04 ||SPBC337.20|mannosyltransferase complex subunit, An... 25 7.2 >SPBC776.06c |||spindle pole body interacting protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 598 Score = 27.1 bits (57), Expect = 2.3 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = -3 Query: 423 EKVLFLTFXXXXXXXXXGMAPSVGLISGATGLATAISSGVLP 298 +KVLFLT + S L+SGATGL ++ P Sbjct: 284 KKVLFLTKTSSASVLADFVLSSCALVSGATGLLQGLTRITFP 325 >SPBC1734.04 ||SPBC337.20|mannosyltransferase complex subunit, Anp family |Schizosaccharomyces pombe|chr 2|||Manual Length = 430 Score = 25.4 bits (53), Expect = 7.2 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 98 TVKILGKTGSTVCLFIFYHRS 36 T++ +G T+ LF+F+HRS Sbjct: 35 TIRTVGIIALTLVLFLFFHRS 55 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,708,845 Number of Sequences: 5004 Number of extensions: 54793 Number of successful extensions: 113 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 113 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -