BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0104 (650 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z66523-2|CAA91410.1| 451|Caenorhabditis elegans Hypothetical pr... 29 2.9 AC084154-3|AAK29869.1| 323|Caenorhabditis elegans Hypothetical ... 27 8.7 >Z66523-2|CAA91410.1| 451|Caenorhabditis elegans Hypothetical protein M05D6.2 protein. Length = 451 Score = 29.1 bits (62), Expect = 2.9 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -2 Query: 613 FPLAYSSIVNHFLAHAPLTHIVFHAXHP 530 F YS+++ F H P TH ++ A P Sbjct: 414 FYAMYSNLIQEFQGHTPSTHAIYRADSP 441 >AC084154-3|AAK29869.1| 323|Caenorhabditis elegans Hypothetical protein Y22D7AR.6 protein. Length = 323 Score = 27.5 bits (58), Expect = 8.7 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -2 Query: 601 YSSIVN-HFLAHAPLTHIVFHAXHPYLLRSTSPLCPCTFIVKTSI 470 ++S+ N H L I+F+ P +L+S +PLC C+ I +S+ Sbjct: 35 FTSLPNGHLLKPCEEREILFYQKMPKILKSIAPLC-CSTIQGSSV 78 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,748,304 Number of Sequences: 27780 Number of extensions: 299331 Number of successful extensions: 567 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 562 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 567 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1444744186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -