BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0103 (699 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bomb... 37 0.55 UniRef50_O23378 Cluster: Putative uncharacterized protein dl3665... 35 1.7 UniRef50_Q6BU12 Cluster: Similar to sp|P22470 Saccharomyces cere... 34 2.9 UniRef50_Q2F5U6 Cluster: Upf3 regulator of nonsense transcripts-... 33 6.7 >UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bombyx mori (Silk moth) Length = 782 Score = 36.7 bits (81), Expect = 0.55 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = +2 Query: 281 YRHSPLSFSLDILSGSRFRSGGRY 352 +R PLSFS D+LSGSRFR+G Y Sbjct: 392 HRCCPLSFSPDLLSGSRFRTGAEY 415 >UniRef50_O23378 Cluster: Putative uncharacterized protein dl3665c; n=2; Arabidopsis thaliana|Rep: Putative uncharacterized protein dl3665c - Arabidopsis thaliana (Mouse-ear cress) Length = 520 Score = 35.1 bits (77), Expect = 1.7 Identities = 24/67 (35%), Positives = 36/67 (53%) Frame = -3 Query: 451 PKMLFPVRPNGLVSSRFRYQNFLTLALARVVFAVSTAGSESRPTENIQRETQRAVSIG*F 272 P+MLFP + L SSR R FL L +++ + + G+ R E I R++S+ F Sbjct: 22 PEMLFPAKSPSLTSSRIR-NIFLLLIFCFIIYIIFSYGTNFR-REQIS-SIARSLSV--F 76 Query: 271 ALRRNHL 251 + RR HL Sbjct: 77 STRRRHL 83 >UniRef50_Q6BU12 Cluster: Similar to sp|P22470 Saccharomyces cerevisiae YDR143c SAN1; n=1; Debaryomyces hansenii|Rep: Similar to sp|P22470 Saccharomyces cerevisiae YDR143c SAN1 - Debaryomyces hansenii (Yeast) (Torulaspora hansenii) Length = 442 Score = 34.3 bits (75), Expect = 2.9 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = -3 Query: 451 PKMLFPVRPNGLVSSRFRYQNFLTLALARVVFAVSTAGSESRPTENIQRETQRAVS 284 P + FPV L++SRF +N TL AR + E + EN +E + VS Sbjct: 143 PSLFFPVDEGALINSRFPSRNLSTLENARPDQILPGYAEEEKMEENQDKEKEEEVS 198 >UniRef50_Q2F5U6 Cluster: Upf3 regulator of nonsense transcripts-like protein B; n=1; Bombyx mori|Rep: Upf3 regulator of nonsense transcripts-like protein B - Bombyx mori (Silk moth) Length = 499 Score = 33.1 bits (72), Expect = 6.7 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = -1 Query: 228 EERPKSTESESSGSDKTCFGRRRA 157 EERPKS+E E S TC G RRA Sbjct: 430 EERPKSSEREGSEETDTCDGERRA 453 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 587,229,415 Number of Sequences: 1657284 Number of extensions: 10564993 Number of successful extensions: 22382 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 21823 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22375 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 55371905986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -