BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0103 (699 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0295 + 2279185-2279368,2279499-2279849,2279960-2280122,228... 29 4.7 08_02_1445 + 27149983-27150382,27151203-27151612,27151955-27152818 28 8.2 >03_01_0295 + 2279185-2279368,2279499-2279849,2279960-2280122, 2280141-2280177,2280747-2281367 Length = 451 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +2 Query: 26 NEMIKMIKYVEMTKITCCTEYIYYLGERIPLDTCF 130 +E+IK+++ + M + TEY LG +P CF Sbjct: 133 SELIKVVEVLHMARCREITEYNLKLGRYVPTRFCF 167 >08_02_1445 + 27149983-27150382,27151203-27151612,27151955-27152818 Length = 557 Score = 27.9 bits (59), Expect = 8.2 Identities = 14/56 (25%), Positives = 28/56 (50%) Frame = -1 Query: 288 CL*VSLLFVVITFVVINKFDEERPKSTESESSGSDKTCFGRRRACVAPSRSDKKQV 121 CL +S+ F+ +T+VV+ + D T + + T G C+ R D++++ Sbjct: 470 CLFISVAFIALTYVVVGRDDWWLAWCTMAIGAVIMLTTLGSMCYCIIAHRMDERKI 525 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,249,057 Number of Sequences: 37544 Number of extensions: 280027 Number of successful extensions: 570 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 557 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 570 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -