BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0103 (699 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. 23 7.0 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 7.0 >L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. Length = 511 Score = 23.4 bits (48), Expect = 7.0 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +2 Query: 284 RHSPLSFSLDILSGS--RFRSGGRYC 355 R+ P+SF LD SGS F R C Sbjct: 85 RYQPISFKLDTRSGSEAEFADMSRRC 110 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.4 bits (48), Expect = 7.0 Identities = 21/74 (28%), Positives = 28/74 (37%) Frame = +2 Query: 71 TCCTEYIYYLGERIPLDTCFLSDRDGATQARLRPKHVXXXXXXXXXXXXXXXXXXXXITT 250 TC T Y+ +LG +PL G +++RP+ V TT Sbjct: 429 TCYTLYLEFLGGLVPL-------LKGKRTSKIRPEFVIFDPQVDEVSTYCTYSSDS--TT 479 Query: 251 KVITTKSKLTYRHS 292 TTKS T HS Sbjct: 480 TTTTTKSASTSSHS 493 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 610,701 Number of Sequences: 2352 Number of extensions: 11941 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -