BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0103 (699 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U97013-2|AAV58868.1| 190|Caenorhabditis elegans Hypothetical pr... 28 7.4 U97013-1|AAB52340.2| 270|Caenorhabditis elegans Hypothetical pr... 28 7.4 AF078157-11|AAG24070.1| 401|Caenorhabditis elegans Hypothetical... 27 9.8 >U97013-2|AAV58868.1| 190|Caenorhabditis elegans Hypothetical protein F28H1.4b protein. Length = 190 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +1 Query: 550 VYCTTMT*TLYFKEIMDLV*NLNW-SCYLKYTFIFSPF 660 ++ TT TLY ++D + ++NW C + Y F ++ F Sbjct: 82 IFVTTSLLTLYLFRVVDTLPSINWIVCEMVYCFAWTVF 119 >U97013-1|AAB52340.2| 270|Caenorhabditis elegans Hypothetical protein F28H1.4a protein. Length = 270 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +1 Query: 550 VYCTTMT*TLYFKEIMDLV*NLNW-SCYLKYTFIFSPF 660 ++ TT TLY ++D + ++NW C + Y F ++ F Sbjct: 162 IFVTTSLLTLYLFRVVDTLPSINWIVCEMVYCFAWTVF 199 >AF078157-11|AAG24070.1| 401|Caenorhabditis elegans Hypothetical protein F25E5.10 protein. Length = 401 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = -1 Query: 279 VSLLFVVITFVVINKFDEERPKSTESESSGSDKTCFGRRR 160 VS LF ++ F+++ + K +E E++ KTC + R Sbjct: 2 VSCLFSLVAFIILASSSVDAFKLSEEENAALQKTCGTKMR 41 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,529,819 Number of Sequences: 27780 Number of extensions: 252627 Number of successful extensions: 544 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 544 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -