BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0103 (699 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g15240.1 68417.m02336 fringe-related protein + weak similarit... 35 0.045 At5g49650.2 68418.m06145 xylulose kinase, putative similar to D-... 31 0.56 At5g49650.1 68418.m06146 xylulose kinase, putative similar to D-... 31 0.56 At3g26110.1 68416.m03252 expressed protein 28 6.8 At1g12380.1 68414.m01431 expressed protein 27 9.0 >At4g15240.1 68417.m02336 fringe-related protein + weak similarity to Fringe [Schistocerca gregaria](GI:6573138);Fringe encodes an extracellular protein that regulates Notch signalling. Length = 488 Score = 35.1 bits (77), Expect = 0.045 Identities = 24/67 (35%), Positives = 36/67 (53%) Frame = -3 Query: 451 PKMLFPVRPNGLVSSRFRYQNFLTLALARVVFAVSTAGSESRPTENIQRETQRAVSIG*F 272 P+MLFP + L SSR R FL L +++ + + G+ R E I R++S+ F Sbjct: 22 PEMLFPAKSPSLTSSRIR-NIFLLLIFCFIIYIIFSYGTNFR-REQIS-SIARSLSV--F 76 Query: 271 ALRRNHL 251 + RR HL Sbjct: 77 STRRRHL 83 >At5g49650.2 68418.m06145 xylulose kinase, putative similar to D-xylulokinase [Pichia stipitis] gi|8100400|gb|AAF72328 Length = 426 Score = 31.5 bits (68), Expect = 0.56 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -2 Query: 200 NPVDPTRH-VSGEGGLALLRRDQIRNRCLAGSSHLNSKYIQ 81 NPVDP + V A L R++IR+RC GS + +KY+Q Sbjct: 327 NPVDPESYMVMLVYKNASLTREEIRDRCAEGSWDVFNKYLQ 367 >At5g49650.1 68418.m06146 xylulose kinase, putative similar to D-xylulokinase [Pichia stipitis] gi|8100400|gb|AAF72328 Length = 558 Score = 31.5 bits (68), Expect = 0.56 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -2 Query: 200 NPVDPTRH-VSGEGGLALLRRDQIRNRCLAGSSHLNSKYIQ 81 NPVDP + V A L R++IR+RC GS + +KY+Q Sbjct: 327 NPVDPESYMVMLVYKNASLTREEIRDRCAEGSWDVFNKYLQ 367 >At3g26110.1 68416.m03252 expressed protein Length = 128 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/41 (34%), Positives = 26/41 (63%) Frame = -1 Query: 300 LSGLCL*VSLLFVVITFVVINKFDEERPKSTESESSGSDKT 178 ++ L L + LLFV I+ V+++ + E+P ST + S+ + T Sbjct: 1 MARLHLALLLLFVAISAVIVSAAENEKPPSTTTASAPTATT 41 >At1g12380.1 68414.m01431 expressed protein Length = 793 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -1 Query: 234 FDEERPKSTESESSGSDKTCF 172 +D+ER +S S SSGS+K CF Sbjct: 461 YDDER-RSCSSSSSGSNKVCF 480 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,555,395 Number of Sequences: 28952 Number of extensions: 231470 Number of successful extensions: 459 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 444 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 459 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -