BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0097 (697 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27803| Best HMM Match : Pkinase (HMM E-Value=2.1e-08) 29 4.8 SB_30272| Best HMM Match : GDI (HMM E-Value=0) 28 8.3 >SB_27803| Best HMM Match : Pkinase (HMM E-Value=2.1e-08) Length = 318 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +2 Query: 41 SNIHNFLSCTIQVTDMYGRPNTMPPRCFPSAMTCPSS 151 SN H F+ +++ + MY +TM P+ P+A S+ Sbjct: 239 SNFHPFVPTSLKSSSMYNNKSTMLPKLPPAATAMTSA 275 >SB_30272| Best HMM Match : GDI (HMM E-Value=0) Length = 1199 Score = 27.9 bits (59), Expect = 8.3 Identities = 17/53 (32%), Positives = 23/53 (43%), Gaps = 4/53 (7%) Frame = +3 Query: 450 WHSPNKYCRSSVTCKFGSVKLT*NIKTACFAYERLQPNRYN----NYEIHELY 596 WH+ N S VTC GSV + ++ C R ++ IHELY Sbjct: 949 WHTDNGNSVSHVTCDVGSVHFS-KVRMTCEGEARYVSRHHSGGLGGITIHELY 1000 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,912,745 Number of Sequences: 59808 Number of extensions: 524295 Number of successful extensions: 1092 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1021 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1091 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1817559367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -