BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0097 (697 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF039035-2|AAB94162.1| 304|Caenorhabditis elegans Hypothetical ... 29 4.2 AF100672-1|AAC68997.2| 334|Caenorhabditis elegans Hypothetical ... 28 5.5 Z69663-5|CAA93512.2| 1002|Caenorhabditis elegans Hypothetical pr... 27 9.7 Z69661-8|CAA93496.2| 1002|Caenorhabditis elegans Hypothetical pr... 27 9.7 DQ178241-1|ABA18180.1| 1010|Caenorhabditis elegans argonaute-lik... 27 9.7 >AF039035-2|AAB94162.1| 304|Caenorhabditis elegans Hypothetical protein C53A3.1 protein. Length = 304 Score = 28.7 bits (61), Expect = 4.2 Identities = 18/44 (40%), Positives = 24/44 (54%) Frame = +1 Query: 538 LHTSDFNQTGIITMKFMNCMCCGLRRAVHKRLCVI*SLCYFNIG 669 L + Q G+ ++ MNC LRRAVH L + S+ Y NIG Sbjct: 262 LELFNLTQLGLHEVQNMNCELIRLRRAVH-HLKLNKSIHYSNIG 304 >AF100672-1|AAC68997.2| 334|Caenorhabditis elegans Hypothetical protein W05E7.2 protein. Length = 334 Score = 28.3 bits (60), Expect = 5.5 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -3 Query: 563 VWLKSLVCKTCCFNILC*FY 504 +W+ +LVC CC+ +L FY Sbjct: 24 LWISTLVCILCCYIVLFPFY 43 >Z69663-5|CAA93512.2| 1002|Caenorhabditis elegans Hypothetical protein F48F7.1 protein. Length = 1002 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 6 RELISCIYYIFSRIFTTFYPV 68 RE+ISC+ FS+ FT PV Sbjct: 185 REIISCLISAFSKYFTNIRPV 205 >Z69661-8|CAA93496.2| 1002|Caenorhabditis elegans Hypothetical protein F48F7.1 protein. Length = 1002 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 6 RELISCIYYIFSRIFTTFYPV 68 RE+ISC+ FS+ FT PV Sbjct: 185 REIISCLISAFSKYFTNIRPV 205 >DQ178241-1|ABA18180.1| 1010|Caenorhabditis elegans argonaute-like protein. Length = 1010 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 6 RELISCIYYIFSRIFTTFYPV 68 RE+ISC+ FS+ FT PV Sbjct: 193 REIISCLISAFSKYFTNIRPV 213 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,684,810 Number of Sequences: 27780 Number of extensions: 397182 Number of successful extensions: 866 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 843 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 866 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1602927856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -