BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0058 (728 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68227-10|CAA92515.1| 95|Caenorhabditis elegans Hypothetical p... 58 8e-09 U97593-4|AAB52877.2| 93|Caenorhabditis elegans Hypothetical pr... 41 0.001 U80845-2|AAK39179.2| 582|Caenorhabditis elegans Hypothetical pr... 29 4.5 >Z68227-10|CAA92515.1| 95|Caenorhabditis elegans Hypothetical protein F49C12.12 protein. Length = 95 Score = 57.6 bits (133), Expect = 8e-09 Identities = 28/55 (50%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +2 Query: 44 CKLCGPKLSLCGLVLSVWGIIQLTLMGVFYYIRAVALLEDLPFD-EKNPPHSIED 205 C L GPK+S +V+SVWG+I L L+GVF+YI+AV L DL F+ P S+ D Sbjct: 5 CPLMGPKMSAFCMVMSVWGVIFLGLLGVFFYIQAVTLFPDLHFEGHGKVPSSVID 59 >U97593-4|AAB52877.2| 93|Caenorhabditis elegans Hypothetical protein C46G7.1 protein. Length = 93 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = +2 Query: 56 GPKLSLCGLVLSVWGIIQLTLMGVFYYIRAVALLEDLPFDEKNPPHSI-EDFVIXVEKGY 232 GP + L L++WG + + ++G +Y ++V L EDLP + K S+ D K Y Sbjct: 3 GPMCTGIFLFLALWGTVFMAILGGLFYNQSVGLFEDLPKESKAMEKSLWADRTTNFNKLY 62 Query: 233 TLNAQXC 253 NA C Sbjct: 63 QQNAYNC 69 >U80845-2|AAK39179.2| 582|Caenorhabditis elegans Hypothetical protein C24A8.1 protein. Length = 582 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = +2 Query: 374 IPL*NCFFFCQKQVAICNYVCN*VVFLSIDNIGKHS*LHITQTIKHRHR 520 +PL C+F+C VA +V +SID + + +T+KHR R Sbjct: 57 LPLFVCYFYCVLDVAASTSSIIHLVLISIDRLVAATKPAEYKTVKHRKR 105 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,285,946 Number of Sequences: 27780 Number of extensions: 323215 Number of successful extensions: 654 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 647 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 654 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1718929214 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -