BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0057 (693 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 22 5.5 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 22 5.5 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 5.5 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 5.5 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 7.2 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 7.2 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 21 9.6 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.8 bits (44), Expect = 5.5 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = -1 Query: 477 YFCLLPENYELTRV 436 YFC LPE + ++ Sbjct: 577 YFCKLPEKFRFVKI 590 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.8 bits (44), Expect = 5.5 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +2 Query: 278 YCTGFLTASSENGLNDMLFDRVSEAPLDEAV 370 +CT + + G D LFD S A D + Sbjct: 68 FCTALVIFYCQEGSVDFLFDNFSAAFQDHNI 98 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 5.5 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +2 Query: 278 YCTGFLTASSENGLNDMLFDRVSEAPLDEAV 370 +CT + + G D LFD S A D + Sbjct: 301 FCTALVIFYCQEGSVDFLFDNFSAAFQDHNI 331 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 5.5 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +2 Query: 278 YCTGFLTASSENGLNDMLFDRVSEAPLDEAV 370 +CT + + G D LFD S A D + Sbjct: 301 FCTALVIFYCQEGSVDFLFDNFSAAFQDHNI 331 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.4 bits (43), Expect = 7.2 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +3 Query: 336 IECRRHLSMKQSCGSYGRLRYN 401 I+C+R + KQ C + R+ Y+ Sbjct: 786 IKCKRIYNEKQCCKNCARVDYS 807 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.4 bits (43), Expect = 7.2 Identities = 7/26 (26%), Positives = 14/26 (53%) Frame = -1 Query: 513 RPQTVKYYYLFIYFCLLPENYELTRV 436 +P + YY+ + + PEN+ T + Sbjct: 296 KPDLIPNYYIAHFINIDPENHNKTEI 321 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.0 bits (42), Expect = 9.6 Identities = 12/35 (34%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = -1 Query: 504 TVKYYYLFI-YFCLLPENYELTRVTPQLLFIMIPY 403 T +YY FI C+ Y T LLF++ Y Sbjct: 100 TYYFYYAFIILLCVYYFYYAFIIFTVHLLFLLCIY 134 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,696 Number of Sequences: 336 Number of extensions: 3495 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18218375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -