BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0055 (547 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory recept... 23 1.3 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 9.3 >AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory receptor candidate 28 protein. Length = 248 Score = 23.4 bits (48), Expect = 1.3 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = -1 Query: 484 YPENSRKKSFYLFFFVYIYGRFHGLYNVKIPEKKNI 377 YP+ S ++F FV I+G+F G+ + +KN+ Sbjct: 24 YPQPSFHQTFS---FVVIFGQFFGIMPLHGVSRKNV 56 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 20.6 bits (41), Expect = 9.3 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +2 Query: 263 YSNSHLRKPQGISLGKY*CLLIK 331 Y N P +SLG+Y C+ K Sbjct: 855 YVNGSEYHPSIVSLGEYKCVTCK 877 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,228 Number of Sequences: 336 Number of extensions: 2382 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13411456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -