BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0052 (603 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4003| Best HMM Match : Ribosomal_L5_C (HMM E-Value=0) 155 3e-38 SB_57821| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_57888| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_6002| Best HMM Match : 7tm_1 (HMM E-Value=6.1e-26) 29 3.8 SB_52577| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_42606| Best HMM Match : Ank (HMM E-Value=3.4e-08) 28 6.7 SB_10426| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_50854| Best HMM Match : ig (HMM E-Value=6.1e-27) 27 8.8 SB_7224| Best HMM Match : TIL (HMM E-Value=8.2) 27 8.8 >SB_4003| Best HMM Match : Ribosomal_L5_C (HMM E-Value=0) Length = 260 Score = 155 bits (375), Expect = 3e-38 Identities = 69/85 (81%), Positives = 78/85 (91%) Frame = +3 Query: 255 RGAKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVL 434 RG KAEEILE+GLKV+EYEL + FSATGNFGFGIQEHIDLGIKYDPSIGIYG+DF+VVL Sbjct: 67 RGPKAEEILEKGLKVKEYELVKGCFSATGNFGFGIQEHIDLGIKYDPSIGIYGMDFFVVL 126 Query: 435 GRPGFNVAHRRRKTGKVGFPHRLTK 509 GRPGFN++ R+ K G+VGFPHRLTK Sbjct: 127 GRPGFNISKRKHKQGRVGFPHRLTK 151 Score = 125 bits (301), Expect = 3e-29 Identities = 61/74 (82%), Positives = 65/74 (87%) Frame = +1 Query: 61 NVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIA 240 N M+ L IRKL LNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKI+ Sbjct: 2 NPMKELRIRKLVLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIS 61 Query: 241 VHCTVEELKQKKSL 282 VHCTV K ++ L Sbjct: 62 VHCTVRGPKAEEIL 75 Score = 27.9 bits (59), Expect = 6.7 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +2 Query: 506 KEDAMKWFQQK 538 K+DAMKWFQQK Sbjct: 151 KDDAMKWFQQK 161 >SB_57821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 941 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +2 Query: 122 VTG*LVPPRCWSNSQDNSLYFP 187 VT LVPP W+ SQD +Y+P Sbjct: 742 VTPPLVPPMPWTGSQDAGMYYP 763 >SB_57888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 565 Score = 28.7 bits (61), Expect = 3.8 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +1 Query: 475 QEKWDFPTASQRRCYEVVPTEI*WYH 552 Q W+ PT +Q Y T+ WYH Sbjct: 233 QANWNHPTKTQANWYHPTKTQANWYH 258 >SB_6002| Best HMM Match : 7tm_1 (HMM E-Value=6.1e-26) Length = 376 Score = 28.7 bits (61), Expect = 3.8 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = -2 Query: 311 FIFSDFQTPLKDFFCFS-SSTVQWTAIFSLRR 219 F +F+ +K FC S +QWT IFS RR Sbjct: 331 FTNKNFKLAVKRLFCGGVSKNMQWTGIFSSRR 362 >SB_52577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 260 Score = 27.9 bits (59), Expect = 6.7 Identities = 17/48 (35%), Positives = 21/48 (43%) Frame = -2 Query: 389 VLDTQVNVFLNTEAKITRGGEVVTPQFIFSDFQTPLKDFFCFSSSTVQ 246 V D QVN FLN E P+ + TP KD C S+T + Sbjct: 21 VTDKQVNDFLNVCIDSKHHKEKPGPEVDYFHHCTPWKDHACCKSNTTK 68 >SB_42606| Best HMM Match : Ank (HMM E-Value=3.4e-08) Length = 551 Score = 27.9 bits (59), Expect = 6.7 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +3 Query: 315 RRDNFSATGNFGFGIQEHIDLGIKYD 392 ++ ++SATG+F ++EHI G + D Sbjct: 306 KKSHYSATGSFDGSVEEHISEGAQED 331 >SB_10426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 318 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +1 Query: 121 GDRLTRAAKVLEQLTGQQPVFSKARY 198 G R TR A +QLT + VFSK Y Sbjct: 66 GSRRTRTAFTHQQLTALEKVFSKTHY 91 >SB_50854| Best HMM Match : ig (HMM E-Value=6.1e-27) Length = 770 Score = 27.5 bits (58), Expect = 8.8 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = -3 Query: 358 IPKPKLPVAEKLSRRNSYSLTFKPLSRISSALAPRLYNGQQSFHYDGYQ 212 IPK KLP L R S P+SR P + QS +DGY+ Sbjct: 713 IPKAKLPPNNSLFRALDAS---GPVSRGPDRRMPDITRANQSARFDGYR 758 >SB_7224| Best HMM Match : TIL (HMM E-Value=8.2) Length = 147 Score = 27.5 bits (58), Expect = 8.8 Identities = 18/69 (26%), Positives = 25/69 (36%) Frame = -3 Query: 469 RLLCATLKPGRXXXXXXXXXXXXIEGSYLIPKSMCS*IPKPKLPVAEKLSRRNSYSLTFK 290 R C T+KP IP C K K P+++ L YS+ F+ Sbjct: 77 RCYCLTVKPCGSKISADPRICPENVADRRIPPLECDIQAKIKTPISKTLLHVRLYSIVFR 136 Query: 289 PLSRISSAL 263 P S+L Sbjct: 137 PTKTQKSSL 145 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,404,337 Number of Sequences: 59808 Number of extensions: 405396 Number of successful extensions: 1125 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1028 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1125 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1463691625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -