BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0050 (695 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC063894-1|AAH63894.1| 816|Homo sapiens DENND2C protein protein. 30 9.1 AL133382-2|CAI19301.1| 871|Homo sapiens DENN/MADD domain contai... 30 9.1 AL133382-1|CAM27633.1| 928|Homo sapiens DENN/MADD domain contai... 30 9.1 >BC063894-1|AAH63894.1| 816|Homo sapiens DENND2C protein protein. Length = 816 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/55 (25%), Positives = 25/55 (45%) Frame = +1 Query: 22 SSEEISPTKESITADESRGHFYNFGSHYEGLTLPKKKNRNPQFALEDLDVLDLTE 186 + +E+ PTK + +ES + H L RNP + + D+++L E Sbjct: 433 TGKELPPTKGETSGNESDAEYLPKNRHKRLAQLQPSSKRNPHYQTLERDLIELQE 487 >AL133382-2|CAI19301.1| 871|Homo sapiens DENN/MADD domain containing 2C protein. Length = 871 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/55 (25%), Positives = 25/55 (45%) Frame = +1 Query: 22 SSEEISPTKESITADESRGHFYNFGSHYEGLTLPKKKNRNPQFALEDLDVLDLTE 186 + +E+ PTK + +ES + H L RNP + + D+++L E Sbjct: 376 TGKELPPTKGETSGNESDAEYLPKNRHKRLAQLQPSSKRNPHYQTLERDLIELQE 430 >AL133382-1|CAM27633.1| 928|Homo sapiens DENN/MADD domain containing 2C protein. Length = 928 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/55 (25%), Positives = 25/55 (45%) Frame = +1 Query: 22 SSEEISPTKESITADESRGHFYNFGSHYEGLTLPKKKNRNPQFALEDLDVLDLTE 186 + +E+ PTK + +ES + H L RNP + + D+++L E Sbjct: 433 TGKELPPTKGETSGNESDAEYLPKNRHKRLAQLQPSSKRNPHYQTLERDLIELQE 487 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 81,611,931 Number of Sequences: 237096 Number of extensions: 1469893 Number of successful extensions: 10139 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6400 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10139 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8007229802 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -