BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0049 (691 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24228| Best HMM Match : Ion_trans (HMM E-Value=4.5e-33) 29 3.6 SB_51365| Best HMM Match : ig (HMM E-Value=0.00037) 28 6.2 >SB_24228| Best HMM Match : Ion_trans (HMM E-Value=4.5e-33) Length = 663 Score = 29.1 bits (62), Expect = 3.6 Identities = 9/14 (64%), Positives = 13/14 (92%) Frame = +1 Query: 625 NSLRLWIWDKFEKP 666 NS++LWIW+ FE+P Sbjct: 168 NSMQLWIWNLFERP 181 >SB_51365| Best HMM Match : ig (HMM E-Value=0.00037) Length = 498 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = +2 Query: 188 KFYKVKFFEVLDLVKARKVFLNVDTLIYLTEISYQFLQH 304 +F+K + F+ LD VKA+ L + + LT+ S +++ H Sbjct: 429 RFWKKEIFDTLDKVKAKLNELYGEDKVSLTDASLRWMYH 467 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,023,603 Number of Sequences: 59808 Number of extensions: 396904 Number of successful extensions: 849 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 807 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 848 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1793485733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -