BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0045 (674 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 24 1.3 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 23 3.0 AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory recept... 22 5.3 AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory recept... 22 5.3 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 7.0 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 23.8 bits (49), Expect = 1.3 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = -2 Query: 409 LIVLIFT*FLNIVFLLKVKAKYYNNFFLEDFVTSNISPS-VICDH 278 +++ +F+ FL + L K AK +EDF + I P V+ DH Sbjct: 221 VVIDVFSKFLKLYPLRKATAKIAAKRLIEDF-SGYIKPKCVLSDH 264 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 22.6 bits (46), Expect = 3.0 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -1 Query: 122 LSLSKIINILNKIYSKNINHLKYKIILKSTFKVKCKN 12 LS+ +++I +K + +N H+K ++ + C N Sbjct: 43 LSIGVVVSIYSKSFHRNEIHIKIVLMFFKEASLYCFN 79 >AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory receptor candidate 45 protein. Length = 379 Score = 21.8 bits (44), Expect = 5.3 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -2 Query: 199 DYCIFSD*ENLMYNYLLEPQYVTN 128 D C + + + + Y L+ Q+VTN Sbjct: 299 DACTIASKQTISWCYKLQEQFVTN 322 >AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory receptor candidate 8 protein. Length = 379 Score = 21.8 bits (44), Expect = 5.3 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -2 Query: 199 DYCIFSD*ENLMYNYLLEPQYVTN 128 D C + + + + Y L+ Q+VTN Sbjct: 299 DACTIASKQTISWCYKLQEQFVTN 322 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.4 bits (43), Expect = 7.0 Identities = 6/20 (30%), Positives = 13/20 (65%) Frame = -2 Query: 172 NLMYNYLLEPQYVTNIIYLC 113 +L+Y +L+ Y ++ Y+C Sbjct: 631 HLLYIFLVGIMYAADVFYIC 650 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,407 Number of Sequences: 336 Number of extensions: 2888 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17593745 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -