BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0041 (692 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0392 + 17131839-17131943,17134182-17134258,17134385-171344... 83 2e-16 11_06_0315 + 22318155-22318210,22319743-22319769,22319868-223199... 79 3e-15 01_06_0575 - 30357556-30357582,30357698-30357944,30358039-303581... 77 1e-14 07_03_0945 - 22791754-22791863,22792295-22792367,22792457-227925... 72 4e-13 08_02_0954 + 22989780-22989883,22989980-22990160,22990218-22990316 71 9e-13 02_05_0743 + 31425827-31425888,31426733-31426759,31426840-314269... 67 1e-11 06_01_0865 - 6571056-6571190,6571737-6571977,6572279-6572401,657... 65 6e-11 09_04_0341 + 16820890-16820993,16821082-16821269,16821412-16821416 63 2e-10 03_02_0377 - 7898075-7898605,7900782-7901000,7901079-7901142,790... 61 9e-10 10_02_0078 - 4992019-4992594,4993156-4993248,4995984-4996202,499... 59 4e-09 02_01_0163 + 1135592-1135623,1135718-1135816,1135904-1135960,113... 55 6e-08 09_06_0070 - 20670387-20670473,20672418-20672645,20673388-206735... 51 1e-06 11_01_0354 + 2665570-2665601,2665796-2665894,2667158-2667202,266... 45 7e-05 12_01_0375 + 2930807-2930838,2930936-2930999,2931127-2931333,293... 31 0.66 08_02_0919 - 22627147-22627326,22627646-22627726,22627827-226281... 29 3.5 08_02_0501 + 17836948-17837373,17837857-17839184,17839270-178393... 29 3.5 09_02_0511 - 10079180-10079355,10079656-10079722,10080144-100801... 28 6.1 08_02_0920 - 22633777-22633791,22635103-22635399,22635491-226356... 28 6.1 03_05_0393 - 23754652-23754768,23754868-23755437 28 6.1 01_05_0148 + 18609853-18610058,18610347-18612669 28 6.1 03_06_0651 + 35297560-35297895,35298881-35298991,35299670-352997... 28 8.1 01_03_0303 + 14792842-14792949,14793659-14793760,14794657-147948... 28 8.1 >11_04_0392 + 17131839-17131943,17134182-17134258,17134385-17134411, 17134512-17134634,17134738-17134981,17135081-17135098 Length = 197 Score = 83.0 bits (196), Expect = 2e-16 Identities = 33/85 (38%), Positives = 54/85 (63%) Frame = +1 Query: 244 LRVPAYMSMKALESPQKDDDTKWLTYWVVYACFSIVEYFSDFIVGWFPLYWLLKCIFVIW 423 L P Y S++A+ESP K DD +WL YW++Y+ ++VE + ++ W P+++ LK +F+ W Sbjct: 66 LLYPLYASVQAMESPSKLDDEQWLAYWILYSFITLVEMLLESLIYWIPIWYELKLLFIAW 125 Query: 424 CYLPTEYNGSLVIYYRIIRPYYQKH 498 LP + G+ IY R +R +KH Sbjct: 126 LALP-NFRGAAFIYNRFVREQLRKH 149 >11_06_0315 + 22318155-22318210,22319743-22319769,22319868-22319990, 22320867-22321110,22321487-22321981 Length = 314 Score = 79.0 bits (186), Expect = 3e-15 Identities = 35/92 (38%), Positives = 52/92 (56%) Frame = +1 Query: 244 LRVPAYMSMKALESPQKDDDTKWLTYWVVYACFSIVEYFSDFIVGWFPLYWLLKCIFVIW 423 L P Y S+KA+E+ DD +WLTYWV+Y+ ++ E I+ W P + +K IF+ W Sbjct: 24 LAYPLYASVKAIETKSPVDDQQWLTYWVMYSLITLFELTFASIIQWLPFWPSMKLIFICW 83 Query: 424 CYLPTEYNGSLVIYYRIIRPYYQKHHGRTMIW 519 LP +NG+ +Y +RP + KH IW Sbjct: 84 LVLP-YFNGAAFVYQNYVRPMFVKHQ-MVNIW 113 >01_06_0575 - 30357556-30357582,30357698-30357944,30358039-30358161, 30358275-30358301,30358475-30358633,30359764-30359948, 30360225-30360293,30360432-30362354,30363018-30363339, 30363506-30363543 Length = 1039 Score = 77.4 bits (182), Expect = 1e-14 Identities = 34/83 (40%), Positives = 51/83 (61%) Frame = +1 Query: 244 LRVPAYMSMKALESPQKDDDTKWLTYWVVYACFSIVEYFSDFIVGWFPLYWLLKCIFVIW 423 L P Y SM+A+ESP DD +WLTYWV+Y+ ++ E ++ WFPL+ +K +F W Sbjct: 904 LLYPLYASMRAIESPSTLDDQQWLTYWVLYSLITLFELSCWKVLQWFPLWPYMKLLFCCW 963 Query: 424 CYLPTEYNGSLVIYYRIIRPYYQ 492 LP +NG+ IY +R Y++ Sbjct: 964 LVLPI-FNGAAYIYETHVRRYFK 985 >07_03_0945 - 22791754-22791863,22792295-22792367,22792457-22792552, 22793268-22793331,22793957-22794008,22794525-22794622, 22795108-22795166,22795981-22796013 Length = 194 Score = 72.1 bits (169), Expect = 4e-13 Identities = 28/86 (32%), Positives = 49/86 (56%) Frame = +1 Query: 250 VPAYMSMKALESPQKDDDTKWLTYWVVYACFSIVEYFSDFIVGWFPLYWLLKCIFVIWCY 429 +P Y + +A+E + + +WL YW Y FSI E F+D I+ P Y+ +K ++W Sbjct: 38 LPVYSTFRAIEKKDQKEKERWLLYWAAYGSFSIAEIFADQILSSVPFYYHVKFAILVWLQ 97 Query: 430 LPTEYNGSLVIYYRIIRPYYQKHHGR 507 P+ +G+ +Y R +RP++ KH + Sbjct: 98 FPSN-SGAKHVYRRYMRPFFLKHQAK 122 >08_02_0954 + 22989780-22989883,22989980-22990160,22990218-22990316 Length = 127 Score = 70.9 bits (166), Expect = 9e-13 Identities = 26/77 (33%), Positives = 51/77 (66%) Frame = +1 Query: 277 LESPQKDDDTKWLTYWVVYACFSIVEYFSDFIVGWFPLYWLLKCIFVIWCYLPTEYNGSL 456 +ESP K DD +WL YW++Y+ +++E ++ ++ W P+++ +K +FV W LP ++ G+ Sbjct: 1 MESPTKVDDEQWLAYWILYSFITLLEMVAEPVLYWIPVWYPVKVLFVAWLVLP-QFKGAS 59 Query: 457 VIYYRIIRPYYQKHHGR 507 IY +++R +K+ R Sbjct: 60 FIYKKLVREQLRKYRAR 76 >02_05_0743 + 31425827-31425888,31426733-31426759,31426840-31426962, 31427252-31427492,31427655-31427780 Length = 192 Score = 66.9 bits (156), Expect = 1e-11 Identities = 29/80 (36%), Positives = 45/80 (56%) Frame = +1 Query: 244 LRVPAYMSMKALESPQKDDDTKWLTYWVVYACFSIVEYFSDFIVGWFPLYWLLKCIFVIW 423 L P Y S++A+E+ DD +WLTYWV+Y+ ++ E ++ W PL+ K F W Sbjct: 26 LAYPLYASVRAIETKSAVDDQQWLTYWVLYSFITLFELTFSPVLEWLPLWSYAKLFFNCW 85 Query: 424 CYLPTEYNGSLVIYYRIIRP 483 LP +NG+ +Y +RP Sbjct: 86 LVLP-YFNGAAHVYEHFVRP 104 >06_01_0865 - 6571056-6571190,6571737-6571977,6572279-6572401, 6572501-6572527,6573954-6574009 Length = 193 Score = 64.9 bits (151), Expect = 6e-11 Identities = 27/82 (32%), Positives = 45/82 (54%) Frame = +1 Query: 244 LRVPAYMSMKALESPQKDDDTKWLTYWVVYACFSIVEYFSDFIVGWFPLYWLLKCIFVIW 423 L P Y S++A+E+ DD +WLTYWV+Y+ ++ E ++ W P + K F W Sbjct: 24 LAYPLYASVRAIETKSPVDDQQWLTYWVLYSFITLFELTFAPVIEWLPFWSYAKLFFNCW 83 Query: 424 CYLPTEYNGSLVIYYRIIRPYY 489 LP ++G+ +Y +RP + Sbjct: 84 LVLPC-FHGAAYVYDHFVRPMF 104 >09_04_0341 + 16820890-16820993,16821082-16821269,16821412-16821416 Length = 98 Score = 62.9 bits (146), Expect = 2e-10 Identities = 25/74 (33%), Positives = 45/74 (60%) Frame = +1 Query: 277 LESPQKDDDTKWLTYWVVYACFSIVEYFSDFIVGWFPLYWLLKCIFVIWCYLPTEYNGSL 456 +ES K DD +WL YW++Y+ +++E ++ W PL++ K +FV W LP ++ G+ Sbjct: 1 MESTSKVDDEQWLVYWILYSLITLMEMALHKVLYWIPLWYEAKVLFVAWLVLP-QFRGAS 59 Query: 457 VIYYRIIRPYYQKH 498 IY + +R +K+ Sbjct: 60 FIYDKFVREQLKKN 73 >03_02_0377 - 7898075-7898605,7900782-7901000,7901079-7901142, 7901226-7901282,7901373-7901471,7901744-7901793, 7902378-7902422,7902967-7903062 Length = 386 Score = 60.9 bits (141), Expect = 9e-10 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 2/84 (2%) Frame = +1 Query: 253 PAYMSMKALE--SPQKDDDTKWLTYWVVYACFSIVEYFSDFIVGWFPLYWLLKCIFVIWC 426 PAY K +E P+ + W YW++ A +++E F DF + W P Y K +F I+ Sbjct: 72 PAYECYKTVELNKPEIEQLIFWCQYWILVALMTVMERFGDFTISWLPFYSEAKLMFFIYL 131 Query: 427 YLPTEYNGSLVIYYRIIRPYYQKH 498 + P + G+ IY RPY +H Sbjct: 132 WYP-KTKGTTYIYGTFFRPYISQH 154 >10_02_0078 - 4992019-4992594,4993156-4993248,4995984-4996202, 4996282-4996345,4996429-4996485,4996573-4996671, 4997296-4997327 Length = 379 Score = 58.8 bits (136), Expect = 4e-09 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 2/84 (2%) Frame = +1 Query: 253 PAYMSMKALE--SPQKDDDTKWLTYWVVYACFSIVEYFSDFIVGWFPLYWLLKCIFVIWC 426 PAY K +E P+ + W YW++ A +++E F DF + W PLY K +F I+ Sbjct: 19 PAYECYKTVELNKPEIEKLIFWCQYWILVALLTVLERFGDFAISWLPLYSEAKLMFFIYL 78 Query: 427 YLPTEYNGSLVIYYRIIRPYYQKH 498 + P G+ +Y RPY ++ Sbjct: 79 WCP-RTKGTSYVYETFFRPYISQY 101 >02_01_0163 + 1135592-1135623,1135718-1135816,1135904-1135960, 1136053-1136116,1136174-1136392,1138562-1138945 Length = 284 Score = 54.8 bits (126), Expect = 6e-08 Identities = 25/86 (29%), Positives = 41/86 (47%), Gaps = 4/86 (4%) Frame = +1 Query: 253 PAYMSMKALE--SPQKDDDTKWLTYWVVYACFSIVEYFSDFIVGWFPLYWLLKCIFVIWC 426 PAY K +E P+ + W YW++ A ++ E D V W P+Y K F+++ Sbjct: 19 PAYDCYKTVELNRPEVEQLRFWCQYWILLAVLTVFERVGDNFVSWLPMYSEAKLAFIVYL 78 Query: 427 YLP--TEYNGSLVIYYRIIRPYYQKH 498 + P + G+ +Y +PY KH Sbjct: 79 WYPKTQHFQGTSYVYESFFKPYIGKH 104 >09_06_0070 - 20670387-20670473,20672418-20672645,20673388-20673508, 20673604-20673702,20673802-20673833 Length = 188 Score = 50.8 bits (116), Expect = 1e-06 Identities = 26/84 (30%), Positives = 41/84 (48%), Gaps = 2/84 (2%) Frame = +1 Query: 253 PAYMSMKALE--SPQKDDDTKWLTYWVVYACFSIVEYFSDFIVGWFPLYWLLKCIFVIWC 426 PAY K LE PQ D W YW++ A + +E + F V W P+Y K V++ Sbjct: 19 PAYDCYKTLELNKPQIDQLRFWCQYWILLAFLTTLETITYFTVSWLPMYGEAKLALVLYL 78 Query: 427 YLPTEYNGSLVIYYRIIRPYYQKH 498 + P + G+ +Y ++P +H Sbjct: 79 WYP-KTRGAKHVYESYLQPVLARH 101 >11_01_0354 + 2665570-2665601,2665796-2665894,2667158-2667202, 2667293-2667356,2667497-2667709,2669960-2670160 Length = 217 Score = 44.8 bits (101), Expect = 7e-05 Identities = 24/78 (30%), Positives = 38/78 (48%) Frame = +1 Query: 250 VPAYMSMKALESPQKDDDTKWLTYWVVYACFSIVEYFSDFIVGWFPLYWLLKCIFVIWCY 429 +PA+ K LE+ + DD L +W Y + + V W P+Y +K F ++ + Sbjct: 18 MPAFECFKTLET--RPDDAHMLRFWCQYWIIVSMVIACESFVSWMPMYGEIKLAFFVYLW 75 Query: 430 LPTEYNGSLVIYYRIIRP 483 P + GS V+Y IRP Sbjct: 76 YP-KTKGSDVVYDSFIRP 92 >12_01_0375 + 2930807-2930838,2930936-2930999,2931127-2931333, 2932385-2932458,2932831-2932858,2933268-2933456 Length = 197 Score = 31.5 bits (68), Expect = 0.66 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +1 Query: 370 IVGWFPLYWLLKCIFVIWCYLPTEYNGSLVIYYRIIRPYYQKH 498 ++ W P+Y +K F ++ + P + GS V+Y +RP ++ Sbjct: 8 LISWMPMYGEIKLAFFVYLWYP-KTKGSDVVYDTFLRPIVMQY 49 >08_02_0919 - 22627147-22627326,22627646-22627726,22627827-22628103, 22629451-22629755,22629835-22629987,22630318-22631076 Length = 584 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -3 Query: 114 VHGLLLSFRLCSMLSLYSCNLDAIVRSFSG*PNV 13 ++ L SFR + L LY C L + F+G PN+ Sbjct: 114 LNSCLFSFRELTSLKLYCCGLPNLPAEFAGFPNL 147 >08_02_0501 + 17836948-17837373,17837857-17839184,17839270-17839380, 17839719-17839998,17840275-17840396,17840451-17840556, 17840814-17841020,17841130-17841255,17841719-17841817, 17842265-17842456,17842555-17843073 Length = 1171 Score = 29.1 bits (62), Expect = 3.5 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 5/47 (10%) Frame = +1 Query: 310 WLTYWVVYACFSIVEYFSDFIVGW-----FPLYWLLKCIFVIWCYLP 435 W T+ V+Y F S + V W PLYWL + V+ +P Sbjct: 1095 WYTFLVIYGSFPPTISTSAYHVFWEACASSPLYWLSTLVIVVTALIP 1141 >09_02_0511 - 10079180-10079355,10079656-10079722,10080144-10080181, 10080255-10080336 Length = 120 Score = 28.3 bits (60), Expect = 6.1 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 358 FSDFIVGWFPLYWLLKCIFVI 420 +S+ IV WFP++ CIFVI Sbjct: 84 YSNGIVQWFPVFEYWSCIFVI 104 >08_02_0920 - 22633777-22633791,22635103-22635399,22635491-22635646, 22636118-22636203,22637969-22638791 Length = 458 Score = 28.3 bits (60), Expect = 6.1 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -3 Query: 114 VHGLLLSFRLCSMLSLYSCNLDAIVRSFSG*PNV 13 +H + S R + L L SC L A FSG PN+ Sbjct: 138 LHAAIFSCRELTKLELGSCRLPAAPSDFSGFPNL 171 >03_05_0393 - 23754652-23754768,23754868-23755437 Length = 228 Score = 28.3 bits (60), Expect = 6.1 Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Frame = +3 Query: 492 EASWSYDDMGQHRETRLKCR---FNAIKKIIMLPVWWADTIRKDQLNLLVFYIC 644 E +WS + Q + LK R N + +L +W+ + +R D+L ++Y C Sbjct: 157 ELNWSSLTLNQLLKCILKFREKKTNIEGNVCLLQIWYWEKVRIDKLATTIYYSC 210 >01_05_0148 + 18609853-18610058,18610347-18612669 Length = 842 Score = 28.3 bits (60), Expect = 6.1 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -1 Query: 461 ITRDPLYSVGR*HQITKMHFNSQYNGNQ 378 + DPL S+ R +T++HF YNG + Sbjct: 714 LKEDPLPSLSRLLNLTELHFTRAYNGEK 741 >03_06_0651 + 35297560-35297895,35298881-35298991,35299670-35299744, 35300165-35300225,35300406-35300479,35300564-35300668, 35301099-35301206,35301604-35301707,35302005-35302223, 35302505-35302646,35302694-35302825,35302962-35303066 Length = 523 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/52 (26%), Positives = 26/52 (50%) Frame = +1 Query: 244 LRVPAYMSMKALESPQKDDDTKWLTYWVVYACFSIVEYFSDFIVGWFPLYWL 399 L + Y+S + ++ PQ +D ++ VV ++ YF+ + LYWL Sbjct: 275 LVISQYVSSQVMQPPQNNDPSQQGAQAVVKFLPLLIGYFALSVPSGLSLYWL 326 >01_03_0303 + 14792842-14792949,14793659-14793760,14794657-14794800, 14794906-14794986,14795078-14795147,14795267-14795337, 14795427-14795594,14796030-14796074,14796449-14796511, 14796594-14796869,14797858-14797971,14798099-14798225, 14798315-14798484,14798743-14798841,14799577-14799630, 14801487-14801522,14801741-14801844,14801952-14802186, 14802377-14802609,14802846-14803346,14803422-14803716, 14805796-14805881,14806952-14807064,14807303-14807385, 14808014-14808866,14809215-14809364,14809963-14811146 Length = 1854 Score = 27.9 bits (59), Expect = 8.1 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = -1 Query: 419 ITKMHFNSQYNGNQPTMKSEKYSTIE-KQAYTTQYVSHFVSSSFCGDS 279 +T M FN YNG QP + + K+A T Y S C DS Sbjct: 1339 VTTMKFNETYNGQQPVVLDWAIGKVGCKEANMTSYACRSKHSE-CVDS 1385 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,450,861 Number of Sequences: 37544 Number of extensions: 435712 Number of successful extensions: 1082 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 1040 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1079 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -