BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0041 (692 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54916| Best HMM Match : TB2_DP1_HVA22 (HMM E-Value=4.76441e-44) 120 1e-27 SB_28902| Best HMM Match : TB2_DP1_HVA22 (HMM E-Value=0.088) 34 0.095 SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 31 0.67 SB_52129| Best HMM Match : Sec23_trunk (HMM E-Value=0) 31 0.89 SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15) 29 2.7 SB_48778| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_37980| Best HMM Match : 7tm_2 (HMM E-Value=5.3e-13) 29 4.7 SB_35466| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_13243| Best HMM Match : COX17 (HMM E-Value=1.7) 28 6.2 SB_5363| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_47115| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_45400| Best HMM Match : MAM (HMM E-Value=0) 28 8.3 SB_18656| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_7842| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 >SB_54916| Best HMM Match : TB2_DP1_HVA22 (HMM E-Value=4.76441e-44) Length = 210 Score = 120 bits (288), Expect = 1e-27 Identities = 47/85 (55%), Positives = 65/85 (76%) Frame = +1 Query: 253 PAYMSMKALESPQKDDDTKWLTYWVVYACFSIVEYFSDFIVGWFPLYWLLKCIFVIWCYL 432 PAY S+KA+ES QKDDDT+WL YWVV+A F+IVE+FSD ++ WFPLY+L K IF+ WC Sbjct: 73 PAYQSVKAVESVQKDDDTQWLIYWVVFASFNIVEFFSDILLSWFPLYFLTKLIFLGWCMA 132 Query: 433 PTEYNGSLVIYYRIIRPYYQKHHGR 507 P +NGS +Y ++I+P+ +H + Sbjct: 133 PVSWNGSDTLYQKVIKPFVLRHQSQ 157 Score = 59.7 bits (138), Expect = 2e-09 Identities = 28/62 (45%), Positives = 40/62 (64%) Frame = +2 Query: 71 DNIEQSLNDKSKPWTKYFELAEQKVGVNRLYIFLGLVAFTGLYLVFGFGAELICNSIGFV 250 +N+E L +K+ +T E+K V +LY+FLGLV LYL+FG+GA+LI +GF Sbjct: 13 ENLENWLEEKNY-FTDALGKVEEKTKVKKLYLFLGLVGVFSLYLIFGYGADLIVTVLGFA 71 Query: 251 YP 256 YP Sbjct: 72 YP 73 >SB_28902| Best HMM Match : TB2_DP1_HVA22 (HMM E-Value=0.088) Length = 110 Score = 34.3 bits (75), Expect = 0.095 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 253 PAYMSMKALESPQKDDDTKWLTYW 324 P Y S+ A+E+P + TKWL YW Sbjct: 87 PVYASISAIENPDYEIGTKWLMYW 110 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +2 Query: 155 RLYIFLGLVAFTGLYLVFGFGAELICNSIGFVYP 256 R+ + L +V FT LY+ G+ A CN I V+P Sbjct: 55 RIQVLL-MVLFTLLYVAEGYAAACFCNVIAVVFP 87 >SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 2735 Score = 31.5 bits (68), Expect = 0.67 Identities = 24/82 (29%), Positives = 36/82 (43%), Gaps = 3/82 (3%) Frame = -3 Query: 543 LILFPCVGPYHRTTMMLL---VVRTNDTVVDHEGPVVFSRQVAPDHEDAL*QPVQWKPAD 373 +I P YHR ++L +V +VV H+ PVV R H+ + V +P Sbjct: 1360 IIYHPPPEVYHRPDVVLHRPDIVIHRPSVVLHQAPVVVHRPAVVYHQPPV---VVHQPPP 1416 Query: 372 DEIGKVLHDRKTGVHHPICKPF 307 ++H T V HP +PF Sbjct: 1417 LVHQPIIHSHDTYVSHPFFEPF 1438 >SB_52129| Best HMM Match : Sec23_trunk (HMM E-Value=0) Length = 942 Score = 31.1 bits (67), Expect = 0.89 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -3 Query: 249 TKPIELHINSAPKPNTKYKPVNATKPKKMYNLFTPTFCSA 130 T+P+ H S+P+P + + PVN T P TP +A Sbjct: 225 TQPLSSHSGSSPQPGSAFSPVN-TPPNAQAQQMTPPSSAA 263 >SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15) Length = 1724 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -1 Query: 134 RLVQNISSMACFCRSDFVLCCLYTLVIWMPL 42 R ++NI + C S F LCC + L W+ L Sbjct: 100 RTLENIRARRCMRTSAFGLCCRFILAHWVKL 130 >SB_48778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1165 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +2 Query: 164 IFLGLVAFTGLYLVFGFGAELICNSIGFVY-PRTCL 268 I++ L + G VFGFGA L+ + + +V+ P CL Sbjct: 1008 IYVRLASVMGFTWVFGFGAALLWSPLWYVFVPLNCL 1043 >SB_37980| Best HMM Match : 7tm_2 (HMM E-Value=5.3e-13) Length = 1297 Score = 28.7 bits (61), Expect = 4.7 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +2 Query: 164 IFLGLVAFTGLYLVFGFGAELICNSIGFVY-PRTCL 268 I++ L A G VFGF AEL+ + +V+ P CL Sbjct: 1198 IYVRLAAVMGFTWVFGFLAELLWTPLWYVFIPLNCL 1233 >SB_35466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 829 Score = 28.7 bits (61), Expect = 4.7 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +1 Query: 337 CFSIVEYFSDFIVGWFPLYWLLKCIFVIWCYLPTEYNGSLVIY 465 C ++V +G F +++ +C CY+P + NGS IY Sbjct: 374 CVTVVHDPPFLKIGEFNIFYDKECTLEHVCYVPVQLNGSESIY 416 >SB_13243| Best HMM Match : COX17 (HMM E-Value=1.7) Length = 483 Score = 28.3 bits (60), Expect = 6.2 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = +1 Query: 259 YMSMKALESPQKDDDTKWLTYWVVYACFSIVEYFSDFIVGWFPLYWLLKCI 411 Y+ + + P+K D WL + + + YF + I +F WL KCI Sbjct: 308 YLWGQDISDPRKFLDNTWLKVFKFQPLWKVKNYFGEQIALYFA--WLGKCI 356 >SB_5363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 297 Score = 28.3 bits (60), Expect = 6.2 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = +1 Query: 259 YMSMKALESPQKDDDTKWLTYWVVYACFSIVEYFSDFIVGWFPLYWLLKCI 411 Y+ + + P+K D WL + + + YF + I +F WL KCI Sbjct: 122 YLWGQDISDPRKFLDNTWLKVFKFQPLWKVKNYFGEQIALYFA--WLGKCI 170 >SB_47115| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 830 Score = 27.9 bits (59), Expect = 8.3 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -1 Query: 326 TQYVSHFVSSSFCGDSRAFI 267 T +V HFV + FCG++R+ + Sbjct: 774 TAFVRHFVLARFCGENRSIV 793 >SB_45400| Best HMM Match : MAM (HMM E-Value=0) Length = 257 Score = 27.9 bits (59), Expect = 8.3 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +1 Query: 406 CIFVIWCYLPTEYNGSLVIYYRIIRP 483 C+ + CY + YN + +YY +RP Sbjct: 162 CVEAVGCYRDSGYNRAFPVYYADLRP 187 >SB_18656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3292 Score = 27.9 bits (59), Expect = 8.3 Identities = 18/79 (22%), Positives = 34/79 (43%) Frame = -3 Query: 273 LHRHVRGYTKPIELHINSAPKPNTKYKPVNATKPKKMYNLFTPTFCSASSKYFVHGLLLS 94 ++ H K + +++ + P KP N KP Y+ T T+ S + + L + Sbjct: 1262 IYLHREQIAKEVGINLMAFPDDVCSKKPCNYLKPNSYYDCNTYTYFSGEPQ-VLSSLKVV 1320 Query: 93 FRLCSMLSLYSCNLDAIVR 37 FR + ++C+ A R Sbjct: 1321 FRTVPVDMKFNCSCPADYR 1339 >SB_7842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 27.9 bits (59), Expect = 8.3 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +2 Query: 29 LKDRTMASKLQEYKDNIEQSLNDKSKPWTKYFELAE-QKVGVNRLYIFLG 175 LKD+T ASK E + EQS+ K + K+ L + Q +Y F G Sbjct: 43 LKDKTKASKATEKPEIFEQSVMGKVQTNIKFHNLEDRQDYRDESVYTFCG 92 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,819,400 Number of Sequences: 59808 Number of extensions: 522399 Number of successful extensions: 1728 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1385 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1721 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -