BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0040 (493 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0211 - 6436275-6436361,6436969-6437235,6438475-6438543,643... 28 3.5 >03_02_0211 - 6436275-6436361,6436969-6437235,6438475-6438543, 6439108-6439236,6439319-6439480,6439558-6439678, 6439813-6439928,6440697-6440762,6441010-6441091, 6441236-6441327,6441430-6441537,6441919-6442013, 6442092-6442234,6442336-6442364,6442452-6442571, 6442645-6442734,6443116-6443181,6443267-6443380, 6443482-6443574 Length = 682 Score = 28.3 bits (60), Expect = 3.5 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = -3 Query: 215 ISLFNLLLINFATLLKKNCVLSRENEMFFQFKSSLCHSPDLXMSL 81 I L + L +LLKK V S ++F +S CHSP +SL Sbjct: 450 ILLTSTELAELRSLLKKTLVDSCGKDLFQSLYASWCHSPMATISL 494 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,827,460 Number of Sequences: 37544 Number of extensions: 175289 Number of successful extensions: 274 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 272 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 274 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1023611560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -