BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0040 (493 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF172329-1|AAF02618.1| 3579|Drosophila melanogaster starry night... 29 4.5 >AF172329-1|AAF02618.1| 3579|Drosophila melanogaster starry night protein protein. Length = 3579 Score = 28.7 bits (61), Expect = 4.5 Identities = 27/85 (31%), Positives = 35/85 (41%), Gaps = 5/85 (5%) Frame = -3 Query: 431 LDVNRYRX---HQSRX*VRGLE-CIVERLWMDSLXPTFRSERETATK*VGRAYVRIXHRP 264 LDVN R HQSR V + CI E +W S+ R +R R + H+ Sbjct: 279 LDVNDERFAIEHQSRDLVASRDVCIAESMWKVSITFNIRCDRRDIVDSDHRLKIVYHHQE 338 Query: 263 CHRTD-ANXEKRIFNLQISLFNLLL 192 + TD A +R Q F L L Sbjct: 339 FNDTDIARRVRRELRNQSPYFELAL 363 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,147,980 Number of Sequences: 53049 Number of extensions: 299921 Number of successful extensions: 429 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 420 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 429 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1721789184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -