BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0038 (696 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC17G9.11c |pyr1||pyruvate carboxylase|Schizosaccharomyces pom... 28 1.5 SPAC1805.04 |nup132|Nup133b, Nup133b|nucleoporin Nup132|Schizosa... 25 7.8 >SPBC17G9.11c |pyr1||pyruvate carboxylase|Schizosaccharomyces pombe|chr 2|||Manual Length = 1185 Score = 27.9 bits (59), Expect = 1.5 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +1 Query: 295 SEIYNHEFPNKQMTRMIFKS 354 S++YNHE P Q+T + F++ Sbjct: 863 SDVYNHEIPGGQLTNLKFQA 882 >SPAC1805.04 |nup132|Nup133b, Nup133b|nucleoporin Nup132|Schizosaccharomyces pombe|chr 1|||Manual Length = 1162 Score = 25.4 bits (53), Expect = 7.8 Identities = 21/74 (28%), Positives = 36/74 (48%), Gaps = 4/74 (5%) Frame = +1 Query: 151 DVEALSTCIRLCELGVDPEVLAHVIKEIRKMGENVKKHLIYKHR*SQLSEIYNHEFPNKQ 330 D+ ST ++ ++ P + H+I + +HL+Y S L EIY+ + NK Sbjct: 218 DISTFSTILQKMKIFNYPSI--HIIALKSPPLFSPYQHLLYVAEASGLLEIYDLKLENKL 275 Query: 331 MTRM----IFKSIL 360 ++ M IFK +L Sbjct: 276 VSGMNLSPIFKQVL 289 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,687,723 Number of Sequences: 5004 Number of extensions: 51728 Number of successful extensions: 156 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 150 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 156 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 321151040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -