BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0038 (696 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY825592-1|AAV70203.1| 160|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825591-1|AAV70202.1| 160|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825586-1|AAV70197.1| 160|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825585-1|AAV70196.1| 160|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825584-1|AAV70195.1| 160|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825583-1|AAV70194.1| 160|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825570-1|AAV70181.1| 157|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825569-1|AAV70180.1| 157|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825554-1|AAV70165.1| 156|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825553-1|AAV70164.1| 156|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 pr... 26 1.3 AY062200-1|AAL58561.1| 151|Anopheles gambiae cytochrome P450 CY... 25 3.0 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 25 3.0 AY745225-1|AAU93492.1| 156|Anopheles gambiae cytochrome P450 pr... 23 9.2 >AY825592-1|AAV70203.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 22 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 73 >AY825591-1|AAV70202.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 22 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 73 >AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 33 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 84 >AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 33 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 84 >AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 33 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 84 >AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 33 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 84 >AY825586-1|AAV70197.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 22 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 73 >AY825585-1|AAV70196.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 22 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 73 >AY825584-1|AAV70195.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 25 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 76 >AY825583-1|AAV70194.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 25 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 76 >AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 33 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 84 >AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 33 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 84 >AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 34 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 85 >AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 34 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 85 >AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 36 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 87 >AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 36 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 87 >AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 33 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 84 >AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 33 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 84 >AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 33 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 84 >AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 33 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 84 >AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 33 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 84 >AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 33 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 84 >AY825570-1|AAV70181.1| 157|Anopheles gambiae cytochrome P450 protein. Length = 157 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 22 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 73 >AY825569-1|AAV70180.1| 157|Anopheles gambiae cytochrome P450 protein. Length = 157 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 22 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 73 >AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 36 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 87 >AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 36 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 87 >AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 34 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 85 >AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 34 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 85 >AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 36 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 87 >AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 36 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 87 >AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 33 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 84 >AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 33 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 84 >AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 33 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 84 >AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 33 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 84 >AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 33 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 84 >AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 33 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 84 >AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 34 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 85 >AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 34 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 85 >AY825554-1|AAV70165.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 21 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 72 >AY825553-1|AAV70164.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 21 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 72 >AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 33 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 84 >AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 33 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 84 >AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 34 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 85 >AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 34 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 85 >AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 34 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 85 >AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 34 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 85 >AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 35 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 86 >AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 35 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 86 >AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 33 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 84 >AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/52 (25%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ ++ ++ G D A + LC LG+ V V E+R++ G++ +K Sbjct: 33 EIKEEVDTIMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 84 >AY062200-1|AAL58561.1| 151|Anopheles gambiae cytochrome P450 CYP4G17 protein. Length = 151 Score = 24.6 bits (51), Expect = 3.0 Identities = 13/48 (27%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +1 Query: 121 QISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKM-GENVKK 261 ++ + G D A + LC LG+ V V E+R++ G++ +K Sbjct: 1 EVDTFMFEGHDTTAAGSSFVLCLLGIHQHVQEQVYAELRQIFGDSKRK 48 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 24.6 bits (51), Expect = 3.0 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +1 Query: 109 QLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKMGENVK-KHLIY 273 ++I Q G D A S L E+ + PE+ + +EI+++ E + K L Y Sbjct: 322 EMIAQCLLFFLAGFDTIATSMTFVLYEVTLAPEIQQRLYEEIQQVSETLDGKALTY 377 >AY745225-1|AAU93492.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 23.0 bits (47), Expect = 9.2 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = +1 Query: 118 HQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKMGE 249 H ++ L+ G + + L EL +P + V+KE+R + E Sbjct: 4 HSVT-FLSEGFETSSSMMSYLLYELASNPSIQDRVVKELRTVLE 46 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 651,266 Number of Sequences: 2352 Number of extensions: 12742 Number of successful extensions: 62 Number of sequences better than 10.0: 53 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 62 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -