BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0038 (696 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC125183-1|AAI25184.1| 82|Homo sapiens similar to RIKEN cDNA 2... 73 1e-12 AL356754-1|CAH70226.1| 82|Homo sapiens protein ( Human DNA seq... 73 1e-12 AL138695-3|CAH72711.1| 82|Homo sapiens protein ( Human DNA seq... 73 1e-12 AY045575-1|AAK92217.1| 4624|Homo sapiens axonemal dynein heavy c... 30 9.1 >BC125183-1|AAI25184.1| 82|Homo sapiens similar to RIKEN cDNA 2410129H14 protein. Length = 82 Score = 72.9 bits (171), Expect = 1e-12 Identities = 32/60 (53%), Positives = 45/60 (75%) Frame = +1 Query: 79 AQVGQARETFQLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKMGENVK 258 A + RET ++ +IS++LNTGLD+E LS C+RLCE G++PE L+ VIKE+RK E +K Sbjct: 16 ANLNAVRETMDVLLEISRILNTGLDMETLSICVRLCEQGINPEALSSVIKELRKATEALK 75 >AL356754-1|CAH70226.1| 82|Homo sapiens protein ( Human DNA sequence from clone RP11-11C5 on chromosome 13 Contains a 60S ribosomal protein L21 (RPL21) pseudogene and the 3' end of a ). Length = 82 Score = 72.9 bits (171), Expect = 1e-12 Identities = 32/60 (53%), Positives = 45/60 (75%) Frame = +1 Query: 79 AQVGQARETFQLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKMGENVK 258 A + RET ++ +IS++LNTGLD+E LS C+RLCE G++PE L+ VIKE+RK E +K Sbjct: 16 ANLNAVRETMDVLLEISRILNTGLDMETLSICVRLCEQGINPEALSSVIKELRKATEALK 75 >AL138695-3|CAH72711.1| 82|Homo sapiens protein ( Human DNA sequence from clone RP11-342J4 on chromosome 13. ). Length = 82 Score = 72.9 bits (171), Expect = 1e-12 Identities = 32/60 (53%), Positives = 45/60 (75%) Frame = +1 Query: 79 AQVGQARETFQLIHQISQLLNTGLDVEALSTCIRLCELGVDPEVLAHVIKEIRKMGENVK 258 A + RET ++ +IS++LNTGLD+E LS C+RLCE G++PE L+ VIKE+RK E +K Sbjct: 16 ANLNAVRETMDVLLEISRILNTGLDMETLSICVRLCEQGINPEALSSVIKELRKATEALK 75 >AY045575-1|AAK92217.1| 4624|Homo sapiens axonemal dynein heavy chain DNAH5 protein. Length = 4624 Score = 29.9 bits (64), Expect = 9.1 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 3/76 (3%) Frame = +1 Query: 232 IRKMGENVKKHLIYKHR*SQLSEIYNHEFPNKQMTRMIFKSILDLSYFNA---PNISRYE 402 I + G+ V ++ + + + YN E P + F SI+D+ + A P R + Sbjct: 2664 INEWGDQVTNEIV--RQLMEQNGFYNLEKPGE------FTSIVDIQFLAAMIHPGGGRND 2715 Query: 403 IPQYLNKNKCLFSCTL 450 IPQ L + +F+CTL Sbjct: 2716 IPQRLKRQFSIFNCTL 2731 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,580,077 Number of Sequences: 237096 Number of extensions: 1661776 Number of successful extensions: 6587 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6461 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6587 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8007229802 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -