BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0037 (693 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 22 4.1 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 21 7.2 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 22.2 bits (45), Expect = 4.1 Identities = 14/52 (26%), Positives = 21/52 (40%) Frame = -3 Query: 322 PARXXXXXXLDRVRYFXGLSLLSSIWQYGRSGGTVEYKL*IRNDCSAATKLL 167 PA +RY + L SS WQ S + +Y + N S ++L Sbjct: 376 PAADELLRRFHEIRYMSTIDLRSSYWQIPLSPESRQYTAFLYNGRSYTYQVL 427 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 21.4 bits (43), Expect = 7.2 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = +1 Query: 91 RVMERFIHRSHQQK 132 ++ME+F RSH+Q+ Sbjct: 311 KLMEKFPERSHEQQ 324 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,506 Number of Sequences: 336 Number of extensions: 3890 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18218375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -